(data stored in ACNUC7421 zone)

EMBL: CP000038.PE110

CP000038.PE110       Location/Qualifiers
FT   CDS_pept        complement(123634..123741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0113"
FT                   /old_locus_tag="SSO_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86908"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Q4"
FT                   /protein_id="AAZ86908.1"
FT                   /translation="MLLHTSVGRLQVVEDAVFLFLHTDKCGALGQFFQA"
     gtgttgctcc acaccagcgt tggaagatta caggttgttg aagatgcggt tttcttgttc        60
     ctgcacacgg ataaatgtgg tgcgcttggt cagttctttc aggcgtga                    108
//

If you have problems or comments...

PBIL Back to PBIL home page