(data stored in ACNUC7421 zone)

EMBL: CP000038.PE220

CP000038.PE220       Location/Qualifiers
FT   CDS_pept        complement(256671..258023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0234"
FT                   /old_locus_tag="SSO_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3515"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87018"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5E4"
FT                   /protein_id="AAZ87018.1"
FT                   /translation="MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLV
FT                   ESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPA
FT                   RTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLL
FT                   YFMQHTRKRLEPQPKSNAENAAQTTVRTLIYAPETLASSTPEAVVPPLPGLPEMKVEVR
FT                   SLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAAT
FT                   VWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALK
FT                   TRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPIESL
FT                   LTQYHDARAQKQNTDALEKQINERLEGVLSRWLLLKNNVMPEAATGTTAEK"
     atgaatagta acgtactgac acaaactatc gttaccggca gtgacccgcg cgggctgccg        60
     gaattcagcg ccatccgcga ggaaataaac aaagccagcc acccgtcaca gcctgagctg       120
     aactggaaac tggtggagtc gctggcgctg gcgattttta aagccaacgg tgtggattta       180
     cacaccgcca cctactatac gcttgcccgg acacggacac agggactggc gggattctgc       240
     gaaggtgcgg aactgctggc ggcaatggta agccacgact gggataagtt ctggccgcag       300
     ggcggcccgg cgcgtactga aatgctggac tggtttaact cccgaaccgg caatattctg       360
     cgtcagcaaa tctcctttgc ggaatccgac ctaccactga tctaccgcac agagcgggca       420
     ttgcagctta tctgcgataa gctccagcag gtggaactga agcgcgttcc gcgcgtggag       480
     aatctgctct attttatgca gcacacgcgt aaacggcttg aaccccagcc gaagagtaac       540
     gctgagaacg ccgcacagac cacggtcaga acgctgattt atgccccgga aacactggca       600
     tcttccacac cagaagcggt agtgcctccc ctgcccggcc tgcctgagat gaaagtggaa       660
     gtgcgcagtc tgacagagaa tcccccacag gccagtgtga taaagcaagg cagtacggta       720
     agagggttta tcgcagggat cgcctgttca gtggctgtcg cctcagcatt gtggtggtgg       780
     caggtctatc cggtgcagca gcaactgtta caggttaacg acaccgctca gggcgcagca       840
     acggtgtgga tggcctcacc tgaactcgaa aactatgagc gcaggctgca acaacttctt       900
     gatacctccc cggtacagcc gctggaaacc gggatgcaga tgatgcgtgt tgccgacagt       960
     cgctggccgg aaagcctgca acagcaacag gcctcgacac aatggaatga ggcactcaaa      1020
     acccgcgcac agagtagccc gcagttgcgt ggctggttgc agacccgcca ggacttacat      1080
     gcttttgcag atctagtgat gcagcgcgag aaagagggac taaccctttc ctatatcaaa      1140
     aatgtcatct ggcaggcgga gcggggactg gggcaggaaa cccccattga gtctctgttg      1200
     acgcagtacc atgatgcccg tgcgcagaag cagaatacag atgcgctgga aaaacaaatt      1260
     aatgagcgac tcgaaggcgt gttaagccgc tggctgctgc tgaagaataa cgtcatgcca      1320
     gaggcggcaa ccggtaccac ggccgaaaaa taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page