(data stored in ACNUC7421 zone)

EMBL: CP000038.PE221

CP000038.PE221       Location/Qualifiers
FT   CDS_pept        complement(258034..258720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0235"
FT                   /old_locus_tag="SSO_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87019"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5E3"
FT                   /protein_id="AAZ87019.1"
FT                   /translation="MEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPDGI
FT                   LDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAV
FT                   ETVSLSGNKRRSVLNLDSQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRS
FT                   ISFSGPWAQFRLFWAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFG
FT                   LSDTLY"
     atggaagtgg actggcgcga cagcgtggtg aaaccgttta acgagcaact ggcaaataac        60
     tatccgttta atccgcgttc tgcacaggat gcctcactgg atgccttcga acgcttcttt       120
     aaaccggatg gcatactgga taccttctac cagcagaacc tgaagctgtt tatcgataat       180
     gacctgagtc tggaggatgg cgataacaac gtcattattc gcgaagatat tattgcgcaa       240
     ctggaaactg cgcagaaaat ccgtgacatc ttcttcagca aacagaacgg tctgggaaca       300
     tcctttgccg tggaaacggt atcgctttca ggcaataaac gccgcagtgt actgaacctt       360
     gacagtcagt tagtcgatta cagccagggc cgtaactata ccgcccatct ggtctggcct       420
     aacaacatgc gcgaaggcaa cgaaagtaag ctgacgctca tcggcaccag cggcaacgcg       480
     ccgcgcagta tcagcttcag cgggccgtgg gcgcagttcc gcctgttctg ggccggacaa       540
     ctgaccggag tacaggatgg caactttacc gtgcgcttta gcgtggacgg tggcgcgatg       600
     acctaccgtg tgcataccga cacggaagat aacccgttca gcggtgggtt gttcagccag       660
     tttggtctgt cagacacact gtactga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page