(data stored in ACNUC7421 zone)

EMBL: CP000038.PE229

CP000038.PE229       Location/Qualifiers
FT   CDS_pept        complement(267548..267847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0243"
FT                   /old_locus_tag="SSO_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87027"
FT                   /db_xref="GOA:Q3Z5D5"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5D5"
FT                   /protein_id="AAZ87027.1"
FT                   /translation="MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQM
FT                   LAMPRSDLRVITRQGDIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEG"
     atgatccaga ttgatcttcc cacgctggta aaacggctga acctgttctc ccgccaggcg        60
     ctggagatgg ccgcctctga atgtatgagt cagcaggcag cggaaattac cgtcagccat       120
     gtgctcattc agatgctcgc catgccacgc agtgacctgc gggttattac ccgccagggc       180
     gatattggca tggaagagtt gcgccaggcg ctgacggtag agaactacac aaccgcccgt       240
     tctgcggaca gctacccggc gttttccccg atgctggttg agtggcttaa agagggctag       300
//

If you have problems or comments...

PBIL Back to PBIL home page