(data stored in ACNUC7421 zone)

EMBL: CP000038.PE23

CP000038.PE23        Location/Qualifiers
FT   CDS_pept        complement(23714..24517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0024"
FT                   /old_locus_tag="SSO_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86821"
FT                   /db_xref="GOA:Q3Z5Z1"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Z1"
FT                   /protein_id="AAZ86821.1"
FT                   /translation="MAASPDIAKTRHQINLSNSTSFSKDGYSSNNTGITGIAGEHDQLN
FT                   YGIYVNQQQQNNDTSLGTNLSWRTPIAIIDGSYSHSKNAWQSGGSISSGLVVWPGGINI
FT                   TNQLSDTFAILDAPGLEGAHINGQKYNRTNSKGQVVYDLIIPHRENHLVLDIANSESET
FT                   ELQGNRQIIAPYRGAVSYVQFTTDQRKPWYIQALRPDGSPLTFGYDVLDLQENNIGVVG
FT                   QGSRLFIRVDEIPTGIKVALNDEQNLFCTITFQHVIDENKTYICQ"
     ttggcagcat cacctgatat tgccaaaaca cgtcaccaaa ttaacttatc gaattcgacc        60
     tcattttcca aagatggcta ttcctccaac aatactggaa ttactggcat agccggtgaa       120
     catgatcagt taaattatgg tatatatgtt aatcagcaac aacaaaataa tgatacctcg       180
     cttggtacga atttaagctg gagaactccc atcgccataa tagatggcag ctatagtcat       240
     tctaaaaacg cctggcaaag tggtggaagt attagtagtg gattagttgt ctggcccggt       300
     ggtattaata tcactaacca gttatccgat acatttgcaa ttctggatgc gcctgggtta       360
     gaaggtgcac atattaatgg acaaaaatac aatcgaacaa acagcaaagg ccaggttgtt       420
     tacgacctga taatacctca tcgtgaaaac catctggtac ttgatatagc aaacagtgaa       480
     agtgaaacag aattgcaggg caatcgtcaa attattgcac cttaccgtgg agcagtttct       540
     tatgtgcagt ttacaactga ccaacgtaag ccctggtata tacaggcact gcgtcccgat       600
     ggttcgccat taacctttgg ctatgacgta ctggatctcc aggaaaataa tattggagtc       660
     gttggccagg gtagtcgcct ttttattcgc gtagatgaaa ttcccactgg aataaaagtt       720
     gctctcaatg atgaacagaa cttattctgt actattactt ttcaacacgt tatcgatgaa       780
     aacaaaacat atatatgcca gtaa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page