(data stored in ACNUC7421 zone)

EMBL: CP000038.PE231

CP000038.PE231       Location/Qualifiers
FT   CDS_pept        complement(268622..269410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0245"
FT                   /old_locus_tag="SSO_0245"
FT                   /product="putative cytoplasmic protein"
FT                   /note="Code: S; COG: COG3522"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87029"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5D3"
FT                   /protein_id="AAZ87029.1"
FT                   /translation="MDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIGSPAQ
FT                   SGIADVAEFMMLQLLNRNQTRFTHHARRSQLHPEDFYLDLAGLLGELMTFTEPSRLPCP
FT                   LDVYDHHDLTKIFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQSATF
FT                   VLAVAANMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFS
FT                   YFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG"
     ttggatgacg attttatccc ctcctgccag aatattcagg tcagtaagaa actgcgtgtt        60
     tatctcaaag aggtacaggg ggccattggc ggacgggcaa gcgatctggc aaaccgtatt       120
     ggctctccgg cgcagagcgg catcgcggat gtggcggaat ttatgatgtt gcagttactt       180
     aaccgtaacc agacccggtt tacccatcac gcccgtcgat cccagctcca cccggaagat       240
     ttctaccttg atcttgccgg gttgctgggt gaactgatga cctttaccga gccgtcgcgc       300
     ctgccctgcc cgcttgatgt gtatgatcat catgacctga ccaaaatatt taaaacgctg       360
     ttaccggaag tcaaacgggc gctgcatacc gtactgtcgc caagagccgt caatctgccg       420
     ctgcatctgc gtgacggtat ctggcaggcc gatatccatg acacagaact gctgcaatct       480
     gccacctttg tgctggccgt ggcggcaaac atgccggtcg atcagatcca gcgccagttt       540
     atccagcagt cgaaaatttc ctcgccggaa aaaatccgca atatggtcag tgtgcagatc       600
     cccggtattc cattgcgtgc ccttatggtg gctccccgcc agcttcctta ccattccggg       660
     ttcagctatt tcgaactcga caagagtggc caggcctgga cagaaatggc tgccgccggg       720
     gccgttgcac tgcatgtttc cggcagtttc ccggatctga acatgcaact gtgggcgata       780
     agagggtaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page