(data stored in ACNUC7421 zone)

EMBL: CP000038.PE237

CP000038.PE237       Location/Qualifiers
FT   CDS_pept        complement(275100..275648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0251"
FT                   /old_locus_tag="SSO_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87035"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5C7"
FT                   /protein_id="AAZ87035.1"
FT                   /translation="MKDLPMHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRK
FT                   DSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWK
FT                   ERSDLERELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPH
FT                   FKFMGANFELSLVGRLDRE"
     gtgaaagatc tgccgatgca tctgttcgaa acgatggggc agattcaggc caaaatccca        60
     accgaggtgc tggtcaccga tcgccgcgaa tttgaactgg ctgaagaggg ttttatcacc       120
     cttaccatgc gtaaagactc tgataatgca gcctttttct ctgcaaactc ggtacaaaaa       180
     ccgaagcact ttccgggaaa agatgcagaa accaactata agctgggtac gcagcttcct       240
     tatctcttca tcatcaatcg gttagcgcac tacatcaagg tgttgcagcg tgaacaactg       300
     gggtcatgga aagaaaggag cgacttagaa agagagctta atacctggat ccgtcagtat       360
     gttgccgacc aggaaaaccc gcctgctgac gtgcgcagcc gcaaacctct gcgcgctgcc       420
     aaagttgagg ttatggatgt agaaggcgaa cccggctggt accaggttgc gctaagcgtg       480
     agacctcatt ttaaatttat gggggcaaat tttgagcttt ccctggttgg ccggttagac       540
     agggagtaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page