(data stored in ACNUC7421 zone)

EMBL: CP000038.PE241

CP000038.PE241       Location/Qualifiers
FT   CDS_pept        278082..278600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0255"
FT                   /old_locus_tag="SSO_0255"
FT                   /product="putative hemolysin co-regulated protein"
FT                   /note="Code: S; COG: COG3157"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87039"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5C3"
FT                   /protein_id="AAZ87039.1"
FT                   /translation="MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFL
FT                   HNVTVPTTPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVE
FT                   GKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGA
FT                   DDWRAPLEA"
     atgccaacac cgtgttatat ctccatcact ggtcagaccc agggaaatat tactgcaggt        60
     gcatttaccg ctgattctgt cggcaacatc tatgtgcagg ggcacgaaga cgagatgctg       120
     gtgcaggaat tcctgcataa cgttactgtc ccgaccactc ctcagtccgg tcagcctgcg       180
     ggtcagcgtg ctcacaagcc tttcattttt accgtggcgc tgaacaaagc ggttccgctg       240
     atgtacaacg cactggcctc cggcgaaatg ctgccaacca ctgaacttca ctggtggcgt       300
     acctctgtgg agggcaaaca ggagcattat ttcactaccc gcctgactga ttcgacgatt       360
     gtcgatatga aactgcatat gccgcattgc caggacccgg cgaaacgcga gttcacccag       420
     ttgctcgagg tttcactggc ctaccgcaaa attgaatggg aacacgtcaa atctggcacc       480
     tccggtgccg acgactggcg cgcaccactg gaagcataa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page