(data stored in ACNUC7421 zone)

EMBL: CP000038.PE28

CP000038.PE28        Location/Qualifiers
FT   CDS_pept        28347..28565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0029"
FT                   /old_locus_tag="SSO_0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86826"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Y6"
FT                   /protein_id="AAZ86826.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGHFLPVICAMAMKS
FT                   HFFLISVLNRRLTLTAVQGILGRFSLF"
     atgtgccggc actcgttacg tagtgatggc gcaggattct accagcttgc ggggtgtgaa        60
     tacagctttt ccgcgataaa aattgcagca ggcggtcact ttcttcccgt gatttgcgcc       120
     atggcaatga aaagccactt ctttctgatt tcggtactca atcgccggtt aaccttgacc       180
     gctgtacaag gtatactcgg acgattttca ctgttttga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page