(data stored in ACNUC7421 zone)

EMBL: CP000038.PE348

CP000038.PE348       Location/Qualifiers
FT   CDS_pept        393774..394229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0370"
FT                   /old_locus_tag="SSO_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87146"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z516"
FT                   /protein_id="AAZ87146.1"
FT                   /translation="MTQHPWSKLQREIYDLLTPTINLQIHCTRYLMRSQNGGSTDLPRY
FT                   WITLDKNVIWDYPKDFIAGNAGVRNFHGETCWYPYLTDICSISDLLREYIDTPKAELLT
FT                   KQFTSDKWGLVNILRAADRRIGMRRLDQLRRKTHNIAALKIIARRSE"
     atgacacaac atccatggag caagttacag cgggagatct atgacttact gacgccaacg        60
     atcaacctgc aaattcactg tacccgttat ctcatgcgca gccaaaatgg tggaagtacc       120
     gatttaccgc gttattggat cacgttggat aaaaacgtga tctgggatta cccgaaagac       180
     tttattgcag gtaacgctgg agtgcgtaat tttcacggtg aaacttgctg gtatccttac       240
     ctgacggata tttgttcaat ttctgattta ttgcgtgaat atattgatac cccaaaagcg       300
     gagctgttaa caaaacaatt taccagcgat aaatgggggt tagtgaatat tctgcgtgct       360
     gctgacaggc gaatagggat gaggcgatta gatcagttac ggcgtaaaac gcataatatt       420
     gctgcgctaa aaattattgc tcgccgtagc gaataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page