(data stored in ACNUC7421 zone)

EMBL: CP000038.PE386

CP000038.PE386       Location/Qualifiers
FT   CDS_pept        433990..434532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0408"
FT                   /old_locus_tag="SSO_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87184"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4X8"
FT                   /protein_id="AAZ87184.1"
FT                   /translation="MGIMYANGQYVEVDCKKAKEYLDKGVHIYGGPEDFLATCRKDMID
FT                   RKTVDDTLPVITVTRSGMRDNFLDKGFSCMDSLFATTNKLGEVANLRVTFSIRRPSGKE
FT                   INQTVGFAPFGLNRLNISFTDYLFGSFTSNSSLILYKPEFERKSCATVRTTIVAATATI
FT                   NGKDVELLKAGAIEQKW"
     ttgggcatta tgtacgccaa tggtcagtat gttgaggtag attgtaagaa agcgaaggaa        60
     tatcttgata aaggtgtcca catttatggt ggcccggaag actttctggc tacttgtcga       120
     aaagacatga ttgacagaaa aacggttgac gatacgttac ccgtgattac ggttacccgt       180
     tctgggatgc gagataattt tttagataaa ggtttttcct gcatggatag cctcttcgcc       240
     accaccaata aattaggcga agtggccaat cttcgcgtga cattcagcat tcgtcgccca       300
     tccggtaagg agattaacca aacggttggc ttcgcgcctt tcggtttaaa ccggctgaat       360
     attagcttta ctgattacct atttggttca tttaccagta attcgtctct tattctttat       420
     aaaccggaat ttgagcgaaa atcttgtgca actgtaagga ccacaatcgt tgccgcaacg       480
     gcaaccatta acggcaagga tgtggagttg ctgaaagcgg gggcaattga acaaaagtgg       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page