(data stored in ACNUC7421 zone)

EMBL: CP000038.PE488

CP000038.PE488       Location/Qualifiers
FT   CDS_pept        complement(546074..549505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0517"
FT                   /old_locus_tag="SSO_0517"
FT                   /product="rhs core protein with extension"
FT                   /note="Code: M; COG: COG3209"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87286"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4M6"
FT                   /protein_id="AAZ87286.1"
FT                   /translation="MLGKTGKSLKSIANKVIRWVTDPVDPVTGAYCDERTDFTLGQTLP
FT                   LSFTRFHSSVLPLHGLTGVGWSDSWSEYAWVREQGNRVDIISQGATLRFAFDGDSDTAV
FT                   NPYHAQYILRRRDDYLELFDRDALSSRFFYDAFPGMRLRHPVTDDTSDDRLAHSPNDRM
FT                   YMLGGMSDTASNRITFERDSQYRITGVSHTDGIRLKLTYHASGYLKAIHRTDNDIQTLA
FT                   TYEQDARGRLTEADARLDYHLFYEYDAADRIIRWSDNDQTWSRFTYDEQGRCVNVTGAE
FT                   GYYNATLDYGDGCTTVTDGKGIHRYYYDPDGNILREEAPDGSTTMYEWDEFHHLLARHS
FT                   PAGRVEKFEYNAAHGQLSRYTAADGAEWQYRYDERGLLSNITDPAGQTWTQQCDERGLP
FT                   VSLVSPQGEETRLAYTAQGLLSGIFRQDERRLGIEYDHHNRPETLTDVMGREHHTEYSG
FT                   HDLPVKMRGPGGQSVRLQWQQHHKLSGIERAGTGAEGFRYDRHGNLLAWTDGNGVVWTM
FT                   EYGPFDFPVARTDGEGHRWQYRYDKDTLQLTEVINPQGESYLYVLDNCGRVTEERDWGG
FT                   VVWRYRYDADGLCTAKVNGLEETILYSRDAAGRLAEIISPEGKTQYAYDKSGRLTGIFS
FT                   PDGTSQRTGYDERGRVNVTTQGRRAIEYNYPDEHTVIRCILPPEDERDRHPGESLLKTT
FT                   YRYNAAGELTEVILPGDETLTFSRDEAGREVLRHSNRGFACEQGWNAAGQPVSQRAGFF
FT                   PAEATWDGLVPSLVREYRYDSAGNVSGVTSREDYGRETRREYRLDRNGQVTAVTASGTG
FT                   LGYGEGDESYGYDSCGYLKAQSAGRHRISEETDQYAGGHRLKQAGNTQYDYDAAGRMVS
FT                   RTRHRDGYRPETERFRWDSRDQLTGYCSAQGELWEYRHDASGRRTEKRCDRKKIRFTYL
FT                   WDGDSIAEIREYRDDKLYSVRHLVFNGFELISQQFSRVRQAHPSVAPQWVTRTNHAVSD
FT                   LTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTGYPDPRGELDPEADPGLLYAGQWQ
FT                   DAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRYVPNPCGWVDPLGLAASSKISS
FT                   LMDYIGDGRRVSGHTGFLDGVRLSRSQINKVMLPTY"
     ttgctgggga aaacaggtaa gtcgttaaaa agtattgcca ataaagtcat cagatgggta        60
     acagatcctg tcgatccggt aaccggcgca tactgcgacg aacgtaccga cttcaccctg       120
     ggccagaccc tccccctctc cttcacccgt ttccacagtt ctgtactgcc gctgcatggc       180
     ctgaccggcg tgggctggag cgactcctgg agcgaatacg cctgggtgcg tgaacaggga       240
     aaccgggtgg atatcatcag ccagggagcc acgctgagat ttgccttcga cggtgacagt       300
     gatacggcgg ttaacccgta tcacgcccag tacattctgc gccgccgcga tgattatctg       360
     gagctgttcg acagggatgc actgagcagc cgcttctttt atgacgcctt tccgggaatg       420
     cgtctgcgcc acccggtgac tgacgatacc agcgatgacc gcctggcaca cagccccaat       480
     gaccggatgt acatgctggg cgggatgagc gacaccgcca gcaaccgcat cacgtttgag       540
     cgcgacagcc agtaccggat cacgggtgtc agtcacaccg acgggatccg gcttaaactg       600
     acgtaccacg ccagcggcta cctgaaagcc attcaccgca cggataacga catacagacg       660
     ctggcgacct acgaacagga tgcgcggggg cggctgacag aagcggatgc gcggctggac       720
     taccacctgt tttatgagta cgacgctgcg gaccggatca tccgctggtc cgataacgac       780
     cagacgtgga gccgtttcac ctacgatgaa cagggccggt gcgtgaatgt caccggggcg       840
     gagggctatt acaacgccac gctggactat ggtgacggct gcaccaccgt gacggacggc       900
     aagggcattc accgttatta ctatgatcct gacggcaata ttctgcggga agaagcgccg       960
     gacggcagca ccaccatgta tgaatgggat gaattccatc acctgctggc ccgccactcc      1020
     cctgccgggc gggtggagaa atttgaatac aacgccgcac acggtcagtt aagccgttac      1080
     acggcggcag acggcgcgga gtggcagtac cgctatgatg agcgcggcct gctcagcaac      1140
     atcaccgacc ctgccgggca gacgtggaca cagcagtgtg atgaacgcgg cctgccggta      1200
     agtctggtgt cgccacaggg cgaagagacc cggctggcat acaccgctca ggggctgctg      1260
     tcgggaatat tccgccagga tgaacggcgt ctgggcatag agtacgacca ccacaaccgg      1320
     ccggaaacac tcaccgacgt gatgggccgt gaacaccaca ccgaatacag cggtcacgac      1380
     ctgccagtga agatgcgcgg ccccggcggt cagtcagtgc ggttacagtg gcagcagcac      1440
     cataaactga gcggcattga acgtgctgga accggcgcgg aaggatttcg ctatgaccgc      1500
     cacggcaacc tgctggcctg gacggacggc aacggtgttg tctggacgat ggaatacggt      1560
     ccgttcgatt ttccggtggc gcgaacggac ggtgaaggcc accgctggca gtaccgctac      1620
     gataaagaca cactgcaact gacagaagtc atcaacccgc agggtgagtc atatctttat      1680
     gttctggata actgcggccg ggtgacggaa gagcgtgact ggggcggcgt ggtctggcgt      1740
     taccgctatg acgccgatgg cctctgtacc gccaaggtta acggcctgga ggaaaccatc      1800
     ctctacagcc gggacgccgc aggccgcctg gcagaaatca tctcgccgga aggcaaaacg      1860
     cagtatgcct atgacaaatc cggcaggctg acgggtatct tcagcccgga cggcacatca      1920
     cagcgcaccg gctatgacga acgcgggcgg gtgaatgtca ccactcaggg ccgacgggcc      1980
     attgaataca actaccccga tgaacacacc gtcatccgct gtatcctgcc accggaagat      2040
     gaacgcgaca gacaccccgg tgaatccctg ctgaaaacca cgtaccgcta caacgccgcc      2100
     ggagaactga cagaggtcat tctgccgggg gatgagacgc tgacgttcag ccgtgatgag      2160
     gcgggacgtg aagtgctccg gcacagtaac cggggttttg cctgtgaaca gggctggaat      2220
     gcagccggtc agcctgtcag tcagcgcgcc ggattttttc cggcagaagc cacatgggac      2280
     gggctggttc cctcactggt acgggagtac cgttacgaca gcgcgggtaa cgtgtcaggc      2340
     gtcaccagcc gggaagatta cggacgggaa acacggcggg agtatcggct ggaccggaac      2400
     ggccaggtca cggcggtgac agcctcaggc accgggctgg gctatggcga aggcgatgag      2460
     tcctatggct atgacagctg cggctacctg aaggcgcagt ctgcgggcag gcaccggata      2520
     agtgaagaga ctgaccagta tgccggaggc caccggctga aacaggccgg aaacacgcag      2580
     tatgactatg acgccgcagg ccggatggtc agccgcacca gacaccgtga cggctaccga      2640
     ccggaaacag agcggttccg gtgggacagc cgggaccagc tgaccgggta ttgcagcgca      2700
     cagggtgagc tgtgggaata ccgccacgac gccagcggca gacgaacaga gaaacgctgc      2760
     gaccggaaga aaatccgctt cacgtatctg tgggacggcg acagtattgc ggaaatccgg      2820
     gaataccgcg atgataaact gtacagcgta aggcacctgg tgtttaacgg ctttgagctg      2880
     ataagccagc agttcagccg ggtacggcag gcgcatccgt cggtggcccc gcagtgggtg      2940
     acgcggacga atcatgcggt gagcgacctg acgggccgcc cgctgatgct ctttaacagt      3000
     gaaggaaaga cggtctggcg accggggcag accagcctgt gggggctggc actcagcctg      3060
     cccgcagaca ccggctaccc ggacccgcgc ggggaactgg acccggaagc cgaccccggc      3120
     ctgctgtatg caggacagtg gcaggatgcg gaatccgggc tgtgctataa tcggttccgg      3180
     tattacgagc cggaaaccgg aatgtacctg gtgagtgatc cgctggggtt gcagggcggg      3240
     gagcagactt accggtatgt gccgaatcct tgtgggtggg ttgatccgct gggattggct      3300
     gcaagttcta aaatcagcag tttgatggac tatattggcg atggtcgtcg tgttagtggg      3360
     catacgggtt tcctggatgg ggttcgttta tcacgtagtc aaataaacaa ggtgatgctg      3420
     ccaacttact ga                                                          3432
//

If you have problems or comments...

PBIL Back to PBIL home page