(data stored in ACNUC7421 zone)

EMBL: CP000038.PE530

CP000038.PE530       Location/Qualifiers
FT   CDS_pept        602410..602871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SSON_0561"
FT                   /old_locus_tag="SSO_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87328"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4I4"
FT                   /protein_id="AAZ87328.1"
FT                   /translation="MLLPWLFPQTKRNNFAAKVNSENQEKLLILRKEDASASSGQSELS
FT                   LVQMGLKQVVASSFWLVFEFQHFKVGCNAARKFPVNGIANAQPQQCGTYRSHNGKLSIA
FT                   IGHFCRIHQRAHTHFAIAKIAEFNPAVHCHHVVWHLFWRTHLGAIQLCV"
     atgcttctgc catggttatt cccacaaacg aaacggaata attttgcagc aaaagtgaac        60
     agtgagaacc aggaaaaatt gctgattttg cgtaaagagg atgcgagtgc atcctctggg       120
     caaagcgagt tatcgcttgt gcagatggga ttaaagcagg tagtcgccag cagcttctgg       180
     ctggtattcg agttccagca cttcaaggtg ggttgcaacg ccgcccggaa gttcccagtg       240
     aatggaatcg ccaacgcgca gccccagcag tgcggcacct accggagcca taacggaaag       300
     ctgagtattg ctatcggtca tttttgccgg atacaccagc gtgcgcacac gcacttcgcc       360
     atcgctaaga ttgcggaatt taacccggct gttcattgtc accacgtcgt gtggcatctc       420
     ttctggcgaa cacatttggg cgcgatccaa ctctgcgttt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page