(data stored in ACNUC7421 zone)

EMBL: CP000038.PFS

CP000038.PFS         Location/Qualifiers
FT   CDS_pept        complement(192598..193296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="SSON_0171"
FT                   /old_locus_tag="SSO_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: F; COG: COG0775"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86964"
FT                   /db_xref="GOA:Q3Z5J8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5J8"
FT                   /protein_id="AAZ86964.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIENRQTISLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV
FT                   ESLVQKLAHG"
     atgaaaatcg gcatcattgg tgcaatggaa gaagaagtta cgctgctgcg tgacaaaatc        60
     gaaaaccgtc aaactatcag tctcggcggt tgcgaaatct ataccggcca actgaatgga       120
     accgaggttg cgcttctgaa atcgggcatc ggtaaagtcg ctgcggcgct gggtgccact       180
     ctgctgttgg aacactgcaa gccagatgtg attattaaca ccggttctgc cggtggcctg       240
     gcaccaacgc tgaaagtggg cgatatcgtt gtctcggacg aagcgcgtta tcacgacgcg       300
     gatgtcacgg catttggtta tgaatacggt cagttaccag gctgtccggc aggctttaaa       360
     gctgacgata aactgatcgc tgccgctgag gcctgcattg ccgaactgaa tcttaacgct       420
     gtacgtggcc tgattgttag cggcgacgct ttcatcaacg gttctgttgg tctggcgaaa       480
     atccgccaca acttcccaca ggccattgct gtagagatgg aagcgacggc aatcgcccat       540
     gtctgccaca atttcaacgt cccgtttgtt gtcgtacgcg ccatctccga cgtggccgat       600
     caacagtctc atcttagctt cgatgagttc ctggctgttg ccgctaaaca gtccagcctg       660
     atggttgagt cactggtgca gaaactggca catggctaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page