(data stored in ACNUC7421 zone)

EMBL: CP000038.PPDD

CP000038.PPDD        Location/Qualifiers
FT   CDS_pept        complement(126337..126777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="SSON_0116"
FT                   /old_locus_tag="SSO_0116"
FT                   /product="prelipin peptidase dependent protein"
FT                   /note="Code: NU; COG: COG4969"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86910"
FT                   /db_xref="GOA:Q3Z5Q2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5Q2"
FT                   /protein_id="AAZ86910.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWARNCNIQSDSALQQACEDVFRFDDAN"
     atggacaagc aacgcggttt tacacttatc gaactgatgg tggttattgg catcattgcc        60
     attttaagcg ccattggtat tcccgcttat caaaactacc tgcgcaaagc tgcactcacc       120
     gacatgctac aaacctttgt gccttaccgt acagccgtag agttgtgcgc gctggaacat       180
     ggtggattag atacctgcga cggtggcagc aatggcattc cctcgcctac caccacccgc       240
     tatgtttcag ccatgagtgt ggcaaaaggc gtggtgtcgc tgaccgggca agaaagtctc       300
     aatggactaa gcgtcgtcat gacaccgggt tgggataacg caaacggcgt caccggctgg       360
     gcgcgcaact gcaatattca aagtgacagc gcattgcagc aagcctgcga agatgtcttc       420
     cgctttgatg acgccaacta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page