(data stored in ACNUC7421 zone)

EMBL: CP000038.PURE

CP000038.PURE        Location/Qualifiers
FT   CDS_pept        524185..524694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SSON_0495"
FT                   /old_locus_tag="SSO_0495"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /note="AIR carboxylase, catalytic subunit; Code: F; COG:
FT                   COG0041"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87270"
FT                   /db_xref="GOA:Q3Z4P2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4P2"
FT                   /protein_id="AAZ87270.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVLHHVEVVSAH
FT                   RTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENP
FT                   DPRGTA"
     atgtcttccc gcaataatcc ggcgcgtgtc gccatcgtga tggggtccaa aagcgactgg        60
     gctaccatgc agttcgccgc cgaaatcttc gaaatcctga atgtcctgca ccacgttgaa       120
     gtggtttctg ctcaccgcac ccccgataaa ctgttcagct tcgccgaaag cgccgaagag       180
     aacggttatc aggtgattat tgcgggcgca ggtggcgcag cgcacctgcc aggcatgatt       240
     gccgccaaaa cgctggtgcc ggtgctgggc gtgccagtac agagcgccgc actgagcggt       300
     gtcgatagcc tctactccat cgtacaaatg ccgcgcggca ttccggtggg tacgctggcg       360
     attggtaaag ctggcgcggc aaacgcggca ttactggcag cacaaattct cgcgactcac       420
     gataaagagc tacaccagcg tctgaatgac tggcgcaaag cacaaactga tgaagtgctg       480
     gaaaacccgg acccgcgagg tacggcatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page