(data stored in ACNUC7421 zone)

EMBL: CP000038.TBPA

CP000038.TBPA        Location/Qualifiers
FT   CDS_pept        complement(82281..83264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="SSON_0074"
FT                   /old_locus_tag="SSO_0074"
FT                   /product="thiamin-binding periplasmic protein"
FT                   /note="Code: H; COG: COG4143"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86869"
FT                   /db_xref="GOA:Q3Z5U3"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5U3"
FT                   /protein_id="AAZ86869.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPKIKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDTFVPFDYGYFTFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVYPAFQNAIPTGNWM
FT                   YPVANVTQPAGFEQLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     gtgttaaaaa aatgtcttcc cctgctgttg ctgtgcacag cgcccgtttt cgctaaaccc        60
     gttctgactg tttataccta cgattccttc gccgccgact gggggcctgg tccaaagatc       120
     aaaaaagctt ttgaagccga ctgtaactgc gaactgaaac tggtggcgct ggaagatggc       180
     gtttcgcttc tcaaccgtct acggatggaa ggcaaaaata gtaaagccga tgtggtgctg       240
     gggctggata acaatctgtt agacgccgcc agtaaaaccg gactatttgc caaaagcggt       300
     gtggcagcgg atgccgttaa cgttcccggc ggctggaata atgacacttt cgtcccgttt       360
     gattacggct atttcacctt cgtctatgac aagaacaaac tgaaaaaccc gccgcaaagc       420
     ctgaaagaat tggttgagag cgatcagaac tggcgggtga tttatcagga tccgcgtacc       480
     agcacgccgg ggctgggtct gctgttgtgg atgcaaaaag tctatggcga tgacgcccca       540
     caagcctggc agaaactggc gaagaaaact gtcacggtca ccaaaggctg gagcgaagcc       600
     tatggcctgt ttttaaaagg cgaaagcgat ctggtactga gttacaccac ctctccggct       660
     tatcacattc tcgaagagaa gaaagataac tacgccgccg cgaacttcag cgaaggtcac       720
     tatctgcagg tggaagtcgc cgcccgcacc gctgccagca agcagccgga gctggcgcaa       780
     aaattcctcc agtttatggt ttatccggct tttcagaatg cgatcccaac cggcaactgg       840
     atgtatccgg tggcaaacgt cacgcagcct gccggttttg aacaattgac caaaccagca       900
     accacgctgg agttcacgcc agccgaagtg gcggcacaac gtcaggcatg gattagcgaa       960
     tggcaacgcg ccgtcagccg ttaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page