(data stored in ACNUC7421 zone)

EMBL: CP000038.VGRG

CP000038.VGRG        Location/Qualifiers
FT   CDS_pept        278810..280951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vgrG"
FT                   /locus_tag="SSON_0256"
FT                   /old_locus_tag="SSO_0256"
FT                   /product="unknown protein associated with Rhs element"
FT                   /note="Code: S; COG: COG3501"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87040"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5C2"
FT                   /protein_id="AAZ87040.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLELSLVSQQF
FT                   LSLEFPQVLDKMAYLTIWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVCPPLWRTGL
FT                   RQNFRIFQNEDIESILATILKENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTFCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWR
FT                   NNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRSGSGTT
FT                   LNNHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNP
FT                   SNQDSSCWIRVAQAWAGTGFGNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYKGSGFNELKFDDATGKEQVYIHVQKNMNTEVLNNRTTDVINNH
FT                   AEKIGNNQAITVTNNQIQNIGVNQIQTVGVNLVETVGSNQIIKVGSNQVEKVGIIRALT
FT                   VGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMKENTGQ
FT                   TAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPV
FT                   PDAPVPKDLPPGMPDMRQF"
     atgtcaaccg gattacgttt cacgctggaa gtggacggcc tgccaccgga tgcttttgcg        60
     gtggtctcct ttcatctgaa ccagtcactc tcttcgctct tttccctcga gctctctctg       120
     gtcagccagc agtttctctc ccttgaattt ccgcaggtac tggacaaaat ggcctacctg       180
     acgatatggc agggcgatga cgtacagcgc cgggtgaaag gtgtggtgac ctggtttgaa       240
     ctgggggaga acgacaaaaa ccagatgctg tacagcatga aggtatgccc accgctgtgg       300
     cgcacagggc tgcgccagaa cttccgtatc ttccagaatg aggacatcga aagcatcctc       360
     gcgacgatcc tgaaggaaaa cggtgtgacc gagtggagtc cgctgttcag cgagccgcat       420
     ccttcccgtg agttttgtgt ccagtacggc gaaactgatt acgatttcct gtgccggatg       480
     gcggcggagg aaggcatctt cttttatgag gagcacgcgc aaaaaagtac cgaccagagc       540
     ctggtcctgt gcgacaccgt gcgttatctg ccggagtcct ttgagatccc ctggaacccg       600
     aacacccgta ccgaggtaag taccttctgc atcagccagt tccgctacag cgcacaaatc       660
     cgtccttctt ccgtggtgac caaagactac acctttaaac gacccggctg ggcagggcgt       720
     tttgatcagg aaggccagta ccaggattac cagcgcacac agtatgaagt gtatgactac       780
     cccggacgtt tcaagggtgc tcacgggcag aactttgccc gctggcagat ggatggctgg       840
     cgcaacaacg cagaagtggc gcgcggaaca agccgttctc cggagatatg gccgggacgg       900
     cgaattgtgc tgacggggca tccgcaggcg aacctgaacc gggaatggca ggtggtggca       960
     agtgaactgc acggcgagca gccgcaggcg gtgccgggac gcagtggttc aggaaccacg      1020
     ctgaataacc actttgcggt aataccggca gaccggacat ggcggccaca gccgttgctg      1080
     aaaccgctgg tggatggccc gcagagcgcc gtcgtgacgg gaccggcagg cgaggaaatc      1140
     ttctgtgatg aacatggccg cgtgcgggtg aaatttaact gggaccgcta taacccgtca      1200
     aaccaggaca gttcatgctg gatccgtgtg gcacaggcgt gggcaggcac cggattcggt      1260
     aaccttgcga taccgcgcgt gggtcaggag gtcattgtgg acttcctcaa cggcgatccg      1320
     gaccagccga ttattatggg gcgtacctac caccaggaaa accgcacacc cggtagcctg      1380
     ccggggacga agacgcagat gaccattcgt tcgaaaacct ataagggcag cgggtttaat      1440
     gaactgaagt ttgacgatgc gacagggaaa gaacaggtct acatccacgt gcagaagaac      1500
     atgaacaccg aggtgctgaa taaccgcacc acggatgtga taaacaacca tgccgaaaaa      1560
     ataggtaaca accaggcgat caccgttacc aataaccaga tccagaacat tggcgttaat      1620
     cagatacaga cggttggtgt caacctggtg gaaacggtgg gcagtaacca gattatcaaa      1680
     gtgggatcaa accaggttga aaaggtgggg atcattcgtg cgctgacggt gggtgtggct      1740
     taccagacga cggtaggcgg cattatgaat acctcggtgg cgttgttgca gtcctcacag      1800
     gtagggctgc ataaatcact gatggtggga atgggctaca gcgtcaatgt agggaataac      1860
     gtcaccttct cggtgggcaa gacgatgaag gaaaacaccg gacaaacagc agtttattct      1920
     gccggtgagc atcttgaact ctgctgtggt aaggcaaggc tggtgctgac gaaggacgga      1980
     agcatatttc tcaacggtac gcacattcat ctggaagggg agtcggatgt gaacggtgat      2040
     gcgccagtga ttaactggaa ctgtggtgcc acacaacctg taccggatgc gcctgtgccg      2100
     aaagatttac cccccggaat gccggatatg cggcaatttt ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page