(data stored in ACNUC7421 zone)

EMBL: CP000038.YAAF

CP000038.YAAF        Location/Qualifiers
FT   CDS_pept        34459..35373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaF"
FT                   /locus_tag="SSON_0035"
FT                   /old_locus_tag="SSO_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: F; COG: COG1957"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86832"
FT                   /db_xref="GOA:Q3Z5Y0"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5Y0"
FT                   /protein_id="AAZ86832.1"
FT                   /translation="MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKT
FT                   TRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPIGIPAF
FT                   LAIRDALMRAPEPVTLVAIGPLTNIALLLSQCPECKPYIRRLVIMGGSSGRGNCTPNAE
FT                   FNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLATLPELNRTGKMLHALFSHYR
FT                   SGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANV
FT                   KVALDLDVKGFQQWVAEVLALAS"
     atgcgtttac ctatcttcct cgatactgac cccggcattg acgatgccgt cgccattgcc        60
     gccgcgattt ttgcccccga actcgacctg caactgatga ccaccgtcgc gggtaatgtc       120
     tcggttgaga aaaccacccg caacgccctg caactgctgc atttctggaa tgcggagatt       180
     ccgctcgccc agggagccgc tgtgccgctg gtacgcgcac cgcgtgatgc agcatctgtg       240
     cacggcgaat cgggaatggc tggctacgac tttgttgagc acaaccgaaa gccaatcggg       300
     ataccagcgt ttctggcgat tcgtgatgcc ctgatgcgtg caccagagcc tgttaccctg       360
     gtggccattg gcccgttaac caatattgcg ctgttacttt cacaatgccc ggaatgtaaa       420
     ccgtatattc gtcgtctggt gatcatgggc ggttcttctg gtcgcggcaa ctgtacacca       480
     aatgccgagt ttaatatcgc tgccgatcca gaagcggctg cctgtgtctt ccgtagcgga       540
     atcgaaatcg tcatgtgcgg tctggatgtc accaatcagg caatattaac ccctgactat       600
     ctcgctactt tgccggagtt gaatcgcacc ggaaaaatgc ttcatgcact gtttagccac       660
     taccgtagcg gcagtatgca aagcggtctg cgaatgcacg atctctgcgc catcgcctgg       720
     ctggtgcgcc cggacttatt caccctcaag ccgtgttttg tcgcggtaga aactcaaggc       780
     gaatttacct caggcacgac ggtggttgat atcgacggtt gcctgggcaa accagccaat       840
     gtaaaggtgg cattggatct ggatgtgaaa ggcttccagc agtgggtggc tgaggtgctg       900
     gctctggcgt cgtaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page