(data stored in ACNUC7421 zone)

EMBL: CP000038.YACL

CP000038.YACL        Location/Qualifiers
FT   CDS_pept        143519..143881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="SSON_0127"
FT                   /old_locus_tag="SSO_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3112"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86921"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5P1"
FT                   /protein_id="AAZ86921.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
     atggattacg aatttctgcg cgatattacc ggagtggtaa aggtgcgtat gtccatgggg        60
     catgaagtgg tcgggcactg gtttaatgaa gaggtgaaag aaaacctggc tttgcttgat       120
     gaagtggaac aagcagcgca cgcactgaaa ggtagcgaac ggtcctggca acgggcaggg       180
     catgaataca ccctgtggat ggacggtgaa gaggtgatgg ttcgcgccaa tcaactggaa       240
     ttcgctggcg atgaaatgga agaagggatg aactactacg acgaagaaag cctgtcgcta       300
     tgcggcgttg aggattttct gcaggtcgtg gcggcttacc gcaatttcgt gcagcagaag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page