(data stored in ACNUC7421 zone)

EMBL: CP000038.YADE

CP000038.YADE        Location/Qualifiers
FT   CDS_pept        154057..155286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="SSON_0138"
FT                   /old_locus_tag="SSO_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: G; COG: COG0726"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86932"
FT                   /db_xref="GOA:Q3Z5N0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5N0"
FT                   /protein_id="AAZ86932.1"
FT                   /translation="MYKQAVILLLMLFTASVSAALPARYMQTIENAAVWAQIGDKMVTV
FT                   GNIRAGQIIAVEPTAASYYAFNFGFGKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQN
FT                   LVTWKDTPVYNAPSVGSAPFGVLADNLRYPILHKLKDRLNQTWYQVRIGDRLAYISALD
FT                   AQPDNGLPVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMAQLEGY
FT                   VKNKINLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFVVTSRIKRHPQKWNPKSL
FT                   QFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNP
FT                   HVWYLSYPFGGFNDKAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETM
FT                   SRLVSNQPQG"
     atgtacaaac aagctgttat tctcctgctg atgctgttta ccgcaagtgt cagtgccgcg        60
     ttacctgccc gttatatgca aaccatcgaa aatgctgcgg tctgggcgca aattggcgac       120
     aagatggtga ccgtggggaa tattcgggcc ggacaaatca ttgccgtgga gcccactgcc       180
     gcaagttatt acgcatttaa ttttggcttt ggtaaagggt ttatcgataa agggcatctc       240
     gagccggttc aggggcgaca aaaagttgaa gacggtttgg gtgacctcaa caagccgctg       300
     agtaatcaga acttagttac ctggaaagat acgccggtct ataacgcgcc gagtgtgggc       360
     agtgcgccat ttggggtatt ggcggacaat ttgcgctacc cgattttgca taaactgaaa       420
     gacaggttaa atcaaacctg gtatcaggtc cgtattggcg atcgactggc ctatatcagc       480
     gcgctggatg cccaacccga taatggcctt ccggtgctaa cttatcacca tattctgcgc       540
     gacgaagaaa acacccgttt tcgccatact tcgacgacca cctcggtacg cgctttcaat       600
     aaccaaatgg cctggctgcg cgacagggga tacgcgacac tgagcatggc gcagctggaa       660
     ggttacgtga agaataagat caatctccct gcgcgagcgg tggtgattac ctttgatgat       720
     ggcctcaagt cggtgagccg ctatgcgtat cctgtattga aacaatatgg catgaaggcg       780
     acggcgtttg ttgttacctc gcgcatcaaa cgtcacccgc agaagtggaa cccaaaatcg       840
     ctgcaattta tgagcgtttc tgagcttaac gaaattcgcg atgtttttga ttttcagtca       900
     catacccatt ttttgcatcg ggtggatggc tatcgccgac ccatattact gagccgtagt       960
     gagcacaata ttctgtttga ttttgcacgt tcacgccgcg ctctggcgca atttaatccg      1020
     catgtctggt atctttcgta tccgtttggc ggatttaatg acaaagccgt gaaggcagca      1080
     aacgatgccg gatttcacct ggcggtgaca accatgaaag gcaaagtaaa accgggggat      1140
     aatccgttgt tactaaaacg actttatatc ttaagaacgg attcgctgga gacgatgtcg      1200
     cggctggtga gtaaccagcc gcagggataa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page