(data stored in ACNUC7421 zone)

EMBL: CP000038.YAEE

CP000038.YAEE        Location/Qualifiers
FT   CDS_pept        complement(237280..237933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="SSON_0212"
FT                   /old_locus_tag="SSO_0212"
FT                   /product="putative transport system permease protein"
FT                   /note="Code: P; COG: COG2011"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87003"
FT                   /db_xref="GOA:Q3Z5F9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5F9"
FT                   /protein_id="AAZ87003.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
     atgtctgagc cgatgatgtg gctgctggtt cgtggcgtat gggaaacgct ggcaatgacc        60
     ttcgtatccg gattttttgg ctttgtgatt ggtctgccgg ttggcgttct gctttatgtc       120
     acgcgtccgg ggcaaattat tgctaacgcg aagctgtatc gtaccgtttc tgcgattgtg       180
     aacattttcc gttccatccc gttcattatc ttgctggtat ggatgattcc gtttacccgc       240
     gttattgtcg gtacatcgat tggtttgcag gcagcaattg ttccgttaac cgttggtgca       300
     gcaccgttta ttgcccgtat ggtcgagaac gctctgctgg agatcccaac cgggttaatt       360
     gaagcttccc gcgcaatggg tgccacgcca atgcagatcg tccgtaaagt gctgttaccg       420
     gaagcgttgc cgggtctggt gaatgcggca actatcaccc tgattaccct ggtcggttat       480
     tccgcgatgg gtggtgcagt cggtgccggt ggtttaggtc agattggcta tcagtatggc       540
     tacatcggct acaacgcgac ggtgatgaat acggtactgg tattgctggt cattctggtt       600
     tatttaattc agttcgcagg cgaccgcatc gtccgggctg tcactcgcaa gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page