(data stored in ACNUC7421 zone)

EMBL: CP000038.YAEF

CP000038.YAEF        Location/Qualifiers
FT   CDS_pept        complement(232493..233326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="SSON_0207"
FT                   /old_locus_tag="SSO_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86998"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5G4"
FT                   /protein_id="AAZ86998.1"
FT                   /translation="MYKMDKPKAYCRLLLPSFLLLSACTVDISQPDPSATAVDAEAKTW
FT                   AVKFQHQSSFTEQSIKEITVPDLKPGDLLFSSSLGVTSFGIRVFSTSSVSHVAIYLGDN
FT                   NVAEATGAGVQIVSLKKAMKHSDKLFVLRVPDLTPQQATDITAFANKIKDSSYNYRGIV
FT                   EFIPFMVTRQMCSLNPFSEDFRQQCVSGLAKAQLSSVGEGDKKSWFCSEFVTDAFAKAG
FT                   HPLTLAQSGWISPADLMHMRTGDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTQ"
     ttgtataaaa tggataaacc aaaggcgtac tgccgcctgc ttctccccag ctttctttta        60
     ctttcggctt gtaccgttga tatcagccag ccagacccat cagccacagc agtagatgcc       120
     gaggcaaaaa catgggctgt caaattccag catcaaagct ctttcaccga acaatcaata       180
     aaagaaataa cggtacctga tctcaaaccc ggcgatttgc tgttctcctc aagccttggg       240
     gtaacctcat ttggaatccg cgtcttcagc acttcctctg tgagtcacgt tgcaatctat       300
     ctgggtgata ataacgttgc agaagcgaca ggcgctggcg tccagatcgt ttcccttaaa       360
     aaagcgatga agcatagtga taagcttttc gtcttacgag tcccggatct taccccgcaa       420
     caagccacag atatcaccgc gtttgccaat aaaatcaaag atagcagtta taactatcgc       480
     ggcattgtcg aatttattcc ctttatggtg actcgccaga tgtgctcact gaatccgttc       540
     tccgaggatt ttcgccaaca gtgcgtcagc ggcctggcga aagcgcagtt aagcagtgtg       600
     ggcgaaggag acaaaaagtc gtggttttgt tcggaatttg tcactgatgc atttgccaaa       660
     gccgggcatc cgcttacgct ggcgcaatca ggctggatta gccctgccga tctgatgcat       720
     atgcgtactg gcgatgtctc tgcgtttaag ccagaaacgc agttacagta tgttgggcac       780
     ctgaagccag ggatttatat caaggcgggt cgctttgttg ggctgactca gtga             834
//

If you have problems or comments...

PBIL Back to PBIL home page