(data stored in ACNUC7421 zone)

EMBL: CP000038.YAEG

CP000038.YAEG        Location/Qualifiers
FT   CDS_pept        197365..198540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeG"
FT                   /locus_tag="SSON_0175"
FT                   /old_locus_tag="SSO_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: KT; COG: COG3835"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86967"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5J5"
FT                   /protein_id="AAZ86967.1"
FT                   /translation="MHNGGLMAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSG
FT                   DRERIGELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEP
FT                   ENLRKYGELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLG
FT                   IDLNQPRVVAIVEVDSGQLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPAL
FT                   NSFGRWDAEDHRKRVEQLITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGK
FT                   QRMPESRCYFYQDLMLPVLLDSLRGDWQANELARPLARLKAMDNNGLLRRTLAAWFRHN
FT                   VQPLATSKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEER"
     gtgcataacg gaggacttat ggctggctgg catcttgata ccaaaatggc gcaggatatc        60
     gtggcacgta ccatgcgcat catcgatacc aatatcaacg taatggatgc ccgcgggcga       120
     attatcggca gcggcgatcg tgagcgtatt ggtgaattgc acgaaggtgc attgctggta       180
     ctttcacagg gacgagtcgt cgatatcgat gacgcggtag cacgtcatct gcacggtgtg       240
     cggcagggga ttaatctacc gttacggctg gaaggtgaaa ttgtcggcgt aattggcctg       300
     acaggtgaac cagagaatct gcgtaaatat ggcgaactgg tctgcatgac ggctgaaatg       360
     atgctggaac agtcgcggtt gatgcacctg ttggcgcagg atagccgttt gcgggaagaa       420
     ctggtgatga acctgattca ggctgaggag aatactcccg cacttactga atgggcgcaa       480
     cggctgggga ttgatctcaa tcaaccgcga gtggtggcta ttgttgaggt cgacagcggt       540
     cagcttggcg tggacagcgc aatggcggag ttacaacaac tgcaaaatgc gctgactacg       600
     cccgagcgta ataatctggt ggcaattgtt tcgctgaccg aaatggtggt gttgaaaccg       660
     gcgttgaact cttttgggcg ctgggatgca gaagatcatc gtaagcgagt tgaacaactg       720
     attacccgca tgaaagagta cggccagctg cgttttcgcg tttcactggg caactatttt       780
     accggtcctg gcagtattgc ccgatcctat cgtacggcga aaacgacgat ggtggtgggt       840
     aaacagcgga tgccagaaag tcgctgctat ttttatcagg atctgatgtt acctgtgtta       900
     ctcgacagtt tgcgtggcga ctggcaggcc aacgaactgg cgcgaccgct ggcgcggctg       960
     aaagcgatgg acaataatgg cttgctgcga cgaacgctgg cggcgtggtt tcgccacaat      1020
     gtgcaaccgc tggctacgtc aaaggcgctg tttattcatc gtaatactct ggagtatcgg      1080
     cttaatcgta tatcggaact gaccgggctt gatttgggta attttgatga caggttgctg      1140
     ctgtatgtgg cgttacaact ggatgaagag cggtag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page