(data stored in ACNUC7421 zone)

EMBL: CP000038.YAEI

CP000038.YAEI        Location/Qualifiers
FT   CDS_pept        complement(199177..199920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeI"
FT                   /locus_tag="SSON_0177"
FT                   /old_locus_tag="SSO_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: R; COG: COG1408"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86969"
FT                   /db_xref="GOA:Q3Z5J3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5J3"
FT                   /protein_id="AAZ86969.1"
FT                   /translation="MHYWELGWFELIRHRLAFFKDNAAPFKILFLADLHYSRFVPLSLI
FT                   SDAIALGIEQKPDLILLGGDYVLFDMPLNFSAFSDVLSPLAECAPTFACFGNHDRPVGT
FT                   EKNHLIGETLKSVGITVLFNQATVIATPNRQFELVGTGDLWAGQCKPPPASEANLPRLM
FT                   LAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVPLVGEPFAPVEDKRYVAGLNAFGERHIY
FT                   TTRGVGSLYGLRLNCRPEVTMLELV"
     atgcattact gggagctagg ctggtttgaa ttaatccgtc accgcctcgc cttttttaaa        60
     gacaacgcag caccattcaa aattcttttt ctggccgatc tccattactc tcgttttgtt       120
     cctttaagcc tgatttctga cgcgattgct cttggcatag aacaaaagcc cgatttgata       180
     ttactgggcg gcgattacgt attatttgat atgccgctga atttttcggc gtttagtgat       240
     gtcctctccc cccttgccga atgtgcgccg acgtttgcct gcttcggcaa ccacgatcgc       300
     cctgttggta cagaaaaaaa tcacttaatt ggcgagacgt tgaaatcagt gggcatcacg       360
     gtgttgttta accaggctac ggtgatcgcc acgccgaaca ggcaattcga actggtaggc       420
     accggtgact tatgggccgg acaatgcaaa ccacctcccg ccagcgaagc aaatctgcca       480
     agactgatgc tggcacataa tcccgacagc aaagaagtca tgcgtgatga accctgggat       540
     ctgatgctgt gcggccatac tcacggcggg caactgcgcg taccgttggt tggtgaacct       600
     tttgcccctg tcgaagataa acgttacgtc gccggattaa atgcctttgg cgaacgacac       660
     atctacacaa cccgtggcgt gggcagtttg tatggtttgc gtctgaactg ccgcccggaa       720
     gtaacgatgc tggaactggt gtag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page