(data stored in ACNUC7421 zone)

EMBL: CP000038.YAEO

CP000038.YAEO        Location/Qualifiers
FT   CDS_pept        complement(230038..230298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeO"
FT                   /locus_tag="SSON_0202"
FT                   /old_locus_tag="SSO_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: K; COG: COG4568"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86994"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5G8"
FT                   /protein_id="AAZ86994.1"
FT                   /translation="MSMNDAYQPINCDDYDNLELTCQHHLMLTLELKDGEKLQAKASDL
FT                   VSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES"
     atgtcaatga atgatgcgta tcaaccaatc aattgtgatg attacgataa tcttgagctc        60
     acctgccagc atcatttaat gctgacactt gagctgaaag atggcgaaaa attgcaggca       120
     aaagccagtg atttagtctc ccgcaaaaat gtggagtatc tggtcgtcga ggccgctggc       180
     gaaacccgcg agctgcgtct ggataaaatt accagcttta gccacccgga aatcggtacg       240
     gtggtggtaa gcgaatcctg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page