(data stored in ACNUC7421 zone)

EMBL: CP000038.YAEP

CP000038.YAEP        Location/Qualifiers
FT   CDS_pept        complement(230285..230485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="SSON_0203"
FT                   /old_locus_tag="SSO_0203"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86995"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5G7"
FT                   /protein_id="AAZ86995.1"
FT                   /translation="MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSE
FT                   AVREKAAYAAANLLVSDYVNE"
     gtggaaaaat attgtgagtt aatacgcaag cggtacgcgg aaatcgccag cggagactta        60
     ggatacgttc cggacgcgct gggctgcgtt ttgaaagtgc tgaatgaaat ggctgccgac       120
     gacgcccttt ctgaggctgt cagggaaaaa gcagcatacg ctgcggcaaa cttactggtg       180
     agcgattatg tcaatgaatg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page