(data stored in ACNUC7421 zone)

EMBL: CP000038.YAER

CP000038.YAER        Location/Qualifiers
FT   CDS_pept        228210..228626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="SSON_0200"
FT                   /old_locus_tag="SSO_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: E; COG: COG0346"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ86992"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5H0"
FT                   /protein_id="AAZ86992.1"
FT                   /translation="MLLTNKGDVMLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEV
FT                   YREARDSWKGDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLES
FT                   HNVKCEAIRVDPYTQKRFTFFNDPDGLPLELYEQ"
     gtgctgttaa caaataaagg agacgttatg ctgggtttaa aacaggttca ccatattgcg        60
     attattgcga cggattatgc ggtgagcaaa gctttctact gcgatattct tggtttcacg       120
     ctgcaaagcg aagtctatcg cgaagcgcgc gactcgtgga aaggggattt ggcgcttaat       180
     gggcaatatg tgattgagct tttctctttt ccgttcccgc cggagcgccc cagccgaccg       240
     gaagcttgcg gcctgcgtca tctggctttt agcgttgatg atatcgatgc ggcagtggcg       300
     caccttgaaa gccataacgt gaagtgtgaa gccatccgtg tcgatccata cacgcaaaaa       360
     cgcttcacgt tctttaacga tccggacggg ctgccgttgg aactgtatga gcagtaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page