(data stored in ACNUC7421 zone)

EMBL: CP000038.YAFD

CP000038.YAFD        Location/Qualifiers
FT   CDS_pept        247559..248359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="SSON_0223"
FT                   /old_locus_tag="SSO_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3021"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87008"
FT                   /db_xref="GOA:Q3Z5F4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z5F4"
FT                   /protein_id="AAZ87008.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
     gtgcgaaaaa acacctatgc catgcgctat gttgccggac aacctgcgga gaggatctta        60
     ccgccggggt cttttgcgag catcggccag gcattaccac ccggagaacc gttaagtacc       120
     gaagagcgta ttcggatcct ggtgtggaac atatacaaac agcaacgcgc tgaatggttg       180
     tcggtattaa agaattacgg caaagacgca catctggtgt tattgcagga agcgcaaaca       240
     acgccagagt tggtacagtt tgcgaccgct aactatcttg ccgccgatca ggtacccgct       300
     ttcgtgctgc cacaacatcc ttctggcgta atgacccttt cggcggcaca tccagtgtat       360
     tgctgcccgt tacgtgaacg agaacccatt ttgcgtctgg cgaagtcggc actggtgacg       420
     gtctatccat tacctgacac ccgcctgttg atggtggtta atatacacgc cgtcaacttc       480
     agtctgggcg tggatgtcta tagtaagcag ttacttccta ttggtgatca gatagctcac       540
     cacagcggcc cggtcattat ggcgggagat ttcaatgcct ggagccgtag aaggatgaac       600
     gcgttatatc gctttgcgcg ggaaatgtcg ctgcgccagg tgcgttttac cgatgatcag       660
     cgccgtcggg cgtttggtcg cccgctcgat tttgttttct accgtggtct gaacgtcagt       720
     gaagcttctg tactggttac gcgcgcttcc gatcacaatc cgctactcgt tgaattcagt       780
     cccggcaagc ctgataaata a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page