(data stored in ACNUC7421 zone)

EMBL: CP000038.YAFE

CP000038.YAFE        Location/Qualifiers
FT   CDS_pept        248363..248986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="SSON_0224"
FT                   /old_locus_tag="SSO_0224"
FT                   /product="putative biotin synthesis protein"
FT                   /note="Code: QR; COG: COG0500"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87009"
FT                   /db_xref="GOA:Q3Z5F3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5F3"
FT                   /protein_id="AAZ87009.1"
FT                   /translation="MSGLPQGRPTFGAAQNVSAVVAYDLSAHMLDVVAQAAEARQLKNI
FT                   TTRQGYAASLPFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIVMDVMSPGH
FT                   PVRDIWLQAVEALRDTSHVRNYASGAWLTLINEANLIVDNLITDKLPLEFSSWVVRMRT
FT                   PEALVDAIRIYQQSASTEVRTYFSLQTDGSFTSDIIMVEAHKAA"
     atgtcaggtc tgccgcaggg cagaccaacg tttggcgctg cgcaaaacgt gagcgcggtg        60
     gtggcgtatg acttatctgc ccacatgctg gatgtcgtgg cacaagccgc cgaagcccgg       120
     caactgaaaa atatcaccac ccgccaggga tatgccgcaa gtctgccatt tgccgataac       180
     gcatttgata ttgttatcag ccgttattct gcccatcact ggcatgatgt tggtgcagca       240
     ctgcgagaag tgaataggat attgaaacct ggcggtaggc tgattgtgat ggatgtaatg       300
     tctccgggtc acccagtgcg cgacatctgg ttacaggcgg tagaagcatt acgcgatacc       360
     tctcacgtac gaaactacgc cagcggtgcg tggttgacgt taatcaatga agccaatctg       420
     atagttgata atttaattac agataagtta ccgctggaat tttcttcatg ggtcgtgaga       480
     atgcgtacgc cagaagcgtt agtagacgct attcgcattt accaacagag cgcatcgaca       540
     gaggtgagaa cgtatttttc cttgcagact gatggctctt tcaccagtga tatcatcatg       600
     gtagaagcac ataaagcggc ataa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page