(data stored in ACNUC7421 zone)

EMBL: CP000038.YAFP

CP000038.YAFP        Location/Qualifiers
FT   CDS_pept        303060..303512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="SSON_0275"
FT                   /old_locus_tag="SSO_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: KR; COG: COG0454"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87059"
FT                   /db_xref="GOA:Q3Z5A3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5A3"
FT                   /protein_id="AAZ87059.1"
FT                   /translation="MNNIQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQIAAWAQID
FT                   ESRWKEKLAKSQVWVAVINAQPVGFISRIEHYIDMLFVDPEYTRRGVASALLKPFIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQHVECRGAWFTNFYMQYKPQH"
     atgaataaca tacaaataag aaactatcag cctggcgatt ttcagcaact atgcgctatt        60
     ttcattagag cggttacgat gaccgccagt cagcattatt ctccacaaca aattgccgcc       120
     tgggcgcaga ttgacgaatc tcgctggaag gagaaactcg cgaaatcaca agtgtgggtt       180
     gcggtcatta atgcacaacc ggttggtttt atttcccgca ttgaacatta tatcgatatg       240
     ttatttgttg accctgaata cacccgccgc ggggttgcca gcgccttgtt aaaaccattt       300
     attaagtctg aatccgaact tacggtagat gccagcataa ccgcaaaacc cttttttgaa       360
     cgttatggtt ttcagacagt taagcagcag cacgttgaat gccggggagc gtggtttact       420
     aatttttata tgcaatataa accgcaacat taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page