(data stored in ACNUC7421 zone)

EMBL: CP000038.YAFQ

CP000038.YAFQ        Location/Qualifiers
FT   CDS_pept        complement(296108..296386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafQ"
FT                   /locus_tag="SSON_0267"
FT                   /old_locus_tag="SSO_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG3041"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87051"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5B1"
FT                   /protein_id="AAZ87051.1"
FT                   /translation="MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNALPLPA
FT                   VYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLRFERTGTHAALFG"
     atgattcaaa gggatattga atactcggga caattttcaa aggatgtaaa acttgcacaa        60
     aagcgtcata aggatatgaa taaattgaaa tatcttatga cgcttcttat caataatgct       120
     ttaccgcttc cagctgttta taaagaccac ccgctgcaag gttcatggaa aggttatcgc       180
     gatgctcatg tcgaaccgga ctggatcctg atttacaaac ttaccgataa acttttacga       240
     tttgagagaa ctggaactca cgcggcgctc tttgggtaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page