(data stored in ACNUC7421 zone)

EMBL: CP000038.YAFV

CP000038.YAFV        Location/Qualifiers
FT   CDS_pept        complement(289566..290336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="SSON_0261"
FT                   /old_locus_tag="SSO_0261"
FT                   /product="putative amidase-type enzyme"
FT                   /EC_number="3.5.-.-"
FT                   /note="Code: R; COG: COG0388"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87045"
FT                   /db_xref="GOA:Q3Z5B7"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5B7"
FT                   /protein_id="AAZ87045.1"
FT                   /translation="MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPKMFT
FT                   SGFAMEAAASSLAQDDVVDWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHF
FT                   YDKRHLFRMADEHLHYKAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLAIYVA
FT                   NWPAPRSLHWQALLTARAIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADA
FT                   HQATRIDAELSMMALREYREKFPAWQDADEFRLR"
     gtgcctggtt tgaagattac gcttttgcag caaccactgg tgtggatgga tggccctgcc        60
     aacctgcgtc attttgatcg tcaactggaa ggtattaccg ggcgcgatgt gatcgttcta       120
     ccgaagatgt ttaccagcgg ctttgccatg gaagcggcag cttcgtcgct agcacaagat       180
     gacgtagtgg actggatgac agctaaggcg cagcagtgca atgcgctgat tgcaggcagt       240
     gttgcattac aaacggagtc tggttcggtt aaccgctttt tgctggttga gccgggcggc       300
     acggtacatt tttatgataa gcgtcatctg ttccgcatgg cagatgagca tctacattat       360
     aaagcgggca atgcgcgagt gattgtggaa tggcgcggct ggcgtatttt gccgttggtg       420
     tgctacgact tacgttttcc ggtgtggtcg cgcaatctca acgattatga cctcgccatc       480
     tacgttgcca actggcctgc tccgcgctct ctgcactggc aggcattgct gacggcccgc       540
     gcgattgaga atcaggcgta tgtggcggga tgcaatcgcg tcggcagcga tggcaacggc       600
     tgccattatc gcggtgacag ccgggtgatt aatccacaag gcgagattat cgctactgcc       660
     gacgcgcatc aggcaacgcg cattgatgcg gagctgtcga tgatggcatt gcgggaatat       720
     agagaaaagt ttccggcatg gcaggatgcg gatgagttta ggttgcggtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page