(data stored in ACNUC7421 zone)

EMBL: CP000038.YAHF

CP000038.YAHF        Location/Qualifiers
FT   CDS_pept        complement(341907..343454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="SSON_0312"
FT                   /old_locus_tag="SSO_0312"
FT                   /product="putative oxidoreductase subunit"
FT                   /note="Code: C; COG: COG0074"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87091"
FT                   /db_xref="GOA:Q3Z571"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z571"
FT                   /protein_id="AAZ87091.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPTLEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRVETPVDEQGLQFARGSKEAVLKAVMLSGVKQENLDLHTLNQPLIADVRARLQPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHGDVYSNIQPDPEFRLQDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
     atgtcagtta aaatagtcat taaaccgaat acctattttg attctgtctc gctgatgtct        60
     atctccacgc gtgcaaataa actcgacggc gtcgagcagg catttgtggc gatggcgacc       120
     gaaatgaaca aaggtgtgct gaaaaattta ggactgctga cgccgacgct ggaacaggcg       180
     aaaaacggcg acctgatgat tgtcatcaat ggtaaatcgg gtgcggacaa cgagcagttg       240
     ctggtggaga ttgaagaact gttcaacacc aaagcgcaaa gcggctcgca cgaggcgcgt       300
     tacgccacta ttgccagcgc caaaaagcat atcccggaaa gtaacctggc ggtgatttcg       360
     gtcaacggtc tgtttgccgc tcgcgaagcg cgtcaggcgc tgcaaaacga tctcaacgtg       420
     atgctgtttt ccgataacgt ctcagttgaa gatgaactgg cgctcaagca gttggcccac       480
     gaaaaagggc tgctgatgat ggggccggac tgcggcacgg cgattattaa cggcgcggcg       540
     ctctgttttg gtaacgccgt gcgtcgcggc aatatcggta ttgttggcgc atccggcacc       600
     ggcagccagg agctgagcgt ccgcattcat gaatttggtg gcggtgtttc acaactgatt       660
     ggcaccggcg ggcgcgacct gagcgagaaa atcggcggcc tgatgatgct cgacgccatc       720
     gggatgctgg aaaacgatcc gcaaactgaa attatcgcac tgatttcaaa acctcccgcg       780
     cctgcggtgg cccgcaaagt gctggaacgc gcacgtgcct gccgcaagcc ggtggtggtc       840
     tgcttcctcg gtcgcgttga aacgccggtg gatgagcagg ggctacagtt tgcccgcggc       900
     agcaaagagg cggtgctaaa agcggtgatg ctctccggcg tgaaacagga aaatctcgac       960
     ctgcatacgc ttaaccagcc gttgattgct gatgtgcgtg cgcgtctgca accgcagcag      1020
     aaatacattc gtggcctgtt ctgcggcggc acgctgtgcg acgaaaccat gttcgcggtg      1080
     atggaaaaac atggcgatgt ctacagcaac attcagcccg atccggaatt ccgcctgcaa      1140
     gatatcaacc gcagcatcaa acacaccttc ctcgactttg gcgatgacga cttcacgaac      1200
     ggcaagccgc atccaatgat tgaccccacc aaccgcatca gtcgcttgat cgaagaggcg      1260
     cgcgatccag aagtggcggt gatcgtgatg gattttgtgc tcggatttgg atcgcatgaa      1320
     gatccggtcg gctccaccat cgaggcgatc aaagaagcga aagcgatcgc cgctgccgaa      1380
     ggacgcgagt tgatcattct cgcctatgtg ctgggtaccg atcttgatac gccatcgtta      1440
     gaacaacaaa gccagatgct gcttgatgcc ggagtgattc tggcgagcag cagcaccaat      1500
     accggattgc tggcgcgtga atttatctgc aaaggggagg aagcctga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page