(data stored in ACNUC7421 zone)

EMBL: CP000038.YAHM

CP000038.YAHM        Location/Qualifiers
FT   CDS_pept        complement(332878..333153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahM"
FT                   /locus_tag="SSON_0303"
FT                   /old_locus_tag="SSO_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87082"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z580"
FT                   /protein_id="AAZ87082.1"
FT                   /translation="MLYGTGFEASMAVQLFKTLLNQIPLLSSLQSGTLPLFGYSGRVRP
FT                   MKKAHTGESGLKWEAKDSSKLIGNKDHALRGLSSPIVGIRQIRLIT"
     ttgttgtatg gtacggggtt cgaggcctcg atggcggtcc aacttttcaa aactcttctg        60
     aatcagatcc ccttattatc atccctgcaa agtggaacat tgccattgtt tggctattca       120
     ggacgggtca gaccaatgaa aaaagcccac acaggggaga gtgggctgaa atgggaagct       180
     aaagactcaa gtaaacttat cggaaataag gaccacgcat tacgggggct atcatcgccg       240
     atagtcggga ttcggcaaat caggttgatt acgtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page