(data stored in ACNUC7421 zone)

EMBL: CP000038.YAHN

CP000038.YAHN        Location/Qualifiers
FT   CDS_pept        332229..332861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="SSON_0302"
FT                   /old_locus_tag="SSO_0302"
FT                   /product="putative cytochrome subunit of dehydrogenase"
FT                   /note="Code: E; COG: COG1280"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87081"
FT                   /db_xref="GOA:Q3Z581"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z581"
FT                   /protein_id="AAZ87081.1"
FT                   /translation="MDPLHAVYLTVGLFVITFFNPGANLFVVVQTSLASGRRAGVLTGL
FT                   GVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQ
FT                   QPISASWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASVIW
FT                   RVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQR"
     atggatcctt tgcacgccgt ttacctgacc gtaggactgt tcgtgattac tttttttaat        60
     ccgggagcca atctctttgt ggtagtacaa accagcctgg cttccggtcg acgcgcaggg       120
     gtgctgaccg gactgggcgt ggcgctgggc gatgcatttt attccgggtt gggtttgttt       180
     ggtcttgcaa cgctaataac gcagtgtgag gagatttttt cgcttatcag aatcgtcggc       240
     ggcgcttatc tcttatggtt tgcgtggtgc agcatgcgcc gccagtcaac accgcaaatg       300
     agcacactac aacaaccgat tagcgcctcc tggtatgtct tttttcgccg cggattaatt       360
     accgatctct ctaacccgca aaccgtttta ttttttatca gtattttctc agtaacatta       420
     aatgccgaaa caccaacatg ggcacgttta atggcctggg cggggattgt gctcgcatca       480
     gttatctggc gagtctttct tagtcaggcg ttttctttgc ccgctgtgcg tcgtgcttat       540
     gggcgtatgc aacgcgttgc cagtcgggtt attggtgcaa ttattggtgt attcgcgcta       600
     cgcctgattt acgaaggggt gacgcagcgg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page