(data stored in ACNUC7421 zone)

EMBL: CP000038.YAIB

CP000038.YAIB        Location/Qualifiers
FT   CDS_pept        384191..384451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="SSON_0357"
FT                   /old_locus_tag="SSO_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87133"
FT                   /db_xref="GOA:Q3Z529"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z529"
FT                   /protein_id="AAZ87133.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
     atgaaaaatc tcattgctga gttgttattt aagcttgccc aaaaagaaga agagtcgaaa        60
     gaactgtgtg cgcaggtaga agctttggag attatcgtca ctgcaatgct tcgcaatatg       120
     gcgcaaaatg accaacagcg gttgattgat caggtagagg gggcgctgta cgaggtaaag       180
     cccgatgcca gcattcctga cgacgatacg gagctgctgc gcgattacgt aaagaagtta       240
     ttgaagcatc ctcgtcagta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page