(data stored in ACNUC7421 zone)

EMBL: CP000038.YAIL

CP000038.YAIL        Location/Qualifiers
FT   CDS_pept        360741..361397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="SSON_0333"
FT                   /old_locus_tag="SSO_0333"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /note="Code: S; COG: COG3122"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87110"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z552"
FT                   /protein_id="AAZ87110.1"
FT                   /translation="MCRCLTRLIKQGRKGLAPNTPTAFTGILAKNYSAGLETKMAKLTL
FT                   QEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEENKKAQLERDKQLSEQQKQAAL
FT                   AKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFVDKLTQAQLINGRLAIARLLV
FT                   DNNSEGEYTIIPASVADKIAQRDASSIVLHSALSAEEQDEDDPYADFKVPDDLMW"
     gtgtgccgat gcctgacgcg ccttattaag caggggcgaa agggacttgc ccccaataca        60
     cccacggcgt ttacaggtat actcgctaaa aattattcag cgggtttgga aacaaagatg       120
     gcaaaactta ccttacaaga gcagttgctc aaagcaggat tagtcaccag caaaaaagcg       180
     gcgaaggtcg agagaacggc gaaaaaatcg cgcgttcagg cgcgtgaagc tcgggctgcg       240
     gtagaagaaa ataaaaaggc acagcttgag cgtgataaac agcttagcga acagcaaaaa       300
     caagcggcgt tggcgaaaga atataaagcc caggtgaagc agctcattga aatgaaccga       360
     atcaccattg ccaatggcga tattggtttt aacttcactg acggcaatct gattaagaag       420
     atttttgtcg ataagctcac acaggcgcag ttgattaatg gtcgtctggc gattgcccgc       480
     ttgttggtcg ataacaatag cgaaggtgaa tacaccatta ttcccgccag tgttgccgat       540
     aaaattgctc agcgtgatgc cagcagtatt gtgttgcaca gcgcgctcag tgccgaagag       600
     caggatgaag acgatccgta tgccgacttc aaagtgcctg atgatttgat gtggtaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page