(data stored in ACNUC7421 zone)

EMBL: CP000038.YAJQ

CP000038.YAJQ        Location/Qualifiers
FT   CDS_pept        429634..430143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="SSON_0403"
FT                   /old_locus_tag="SSO_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG1666"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87179"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4Y3"
FT                   /protein_id="AAZ87179.1"
FT                   /translation="MKGEEKMPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASF
FT                   ELNDASKTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKL
FT                   KQGIESATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQ
FT                   FKNFRD"
     atgaagggag aggaaaagat gccatctttc gatattgtct ctgaagttga tcttcaggaa        60
     gcacgtaacg cggtcgataa cgcgagccgc gaagtggagt cccgttttga cttccgtaat       120
     gttgaagcct catttgagct gaacgacgcc agcaaaacca tcaaagtgtt gagcgagtcc       180
     gatttccagg tcaatcagtt gctggatatt ctgcgtgcca agctgctgaa gcgcggcatt       240
     gaaggcagtt cactggatgt accggaaaat atcgttcata gcggtaaaac ctggtttgtg       300
     gaagcgaaac tgaaacaggg cattgagagc gcgacccaga agaaaatcgt caagatgatt       360
     aaagacagca aactgaaagt gcaggcgcaa attcagggcg atgagatccg tgtgactggc       420
     aaatctcgtg atgatttgca ggctgtcatg gcgatggtac gtggtggcga tctcggccag       480
     ccgttccagt tcaaaaactt ccgcgattaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page