(data stored in ACNUC7421 zone)

EMBL: CP000038.YAJR

CP000038.YAJR        Location/Qualifiers
FT   CDS_pept        complement(430271..431641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="SSON_0404"
FT                   /old_locus_tag="SSO_0404"
FT                   /product="putative transport protein"
FT                   /note="Code: GEPR; COG: COG0477"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87180"
FT                   /db_xref="GOA:Q3Z4Y2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4Y2"
FT                   /protein_id="AAZ87180.1"
FT                   /translation="MVMNDYKMTPGERRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQ
FT                   GASEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIW
FT                   GIILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITHK
FT                   LGLHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRLLKLNFG
FT                   IMCLHMLLMSTFVALPGQLADAGFPAAEHWKVYLATMLIAFGSIVPFIIYAEVKRKMKQ
FT                   VFVFCVGLIVVAEIVLWNAQTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYKGT
FT                   AMGVYSTSQFLGVAIGGSLGGWIDGMFDGQGVFLAGAMLAAVWLAVASTMKEPPYVSSL
FT                   RIEIPADIAANEALKVRLLETEGVKEVLIAEEEHSAYVKIDSKVTNRFEVEQAIRQA"
     gtggtaatga acgattataa aatgacgcca ggtgagaggc gcgcgacctg gggtttaggg        60
     accgtattct cgttgcgcat gctgggcatg tttatggttc tgccggttct gaccacgtac       120
     ggcatggctc tgcaaggtgc cagcgaagca ttaatcggta ttgccattgg tatttatggt       180
     ctgactcagg ccgtttttca gattccgttt ggcctgcttt ccgaccgcat tggtcgcaaa       240
     ccattaattg tcggtgggct ggcggtgttt gccgccggta gcgttatcgc tgcgctttcc       300
     gactccatct ggggaattat tctgggccgg gcgctacaag gctctggagc aattgccgcc       360
     gccgttatgg cgctgctttc cgatctcacg cgcgaacaaa accgcaccaa agcgatggcg       420
     tttatcggcg tgagctttgg cattaccttt gccattgcga tggtgcttgg cccgatcatc       480
     actcacaaac ttgggctgca cgcgctgttc tggatgatcg ctattctggc aacaaccggc       540
     attgcgttga ccatttgggt tgtgcccaac agtagcactc acgtacttaa tcgtgagtcc       600
     ggaatggtga aaggcagttt cagtaaagtg ctggcggaac cgcggctgct gaaactcaac       660
     tttggcatta tgtgtctgca catgcttctg atgtctacgt ttgttgccct gcccggacag       720
     ctagctgatg cggggttccc ggcggctgaa cactggaagg tctatctggc gacgatgtta       780
     atcgcctttg gctcgatcgt gcctttcatt atctacgctg aagttaagcg caaaatgaag       840
     caagtctttg tcttctgcgt cgggttgatc gtggttgcgg aaattgtgtt gtggaacgca       900
     caaacgcagt tctggcaact ggtggtcggc gtgcagcttt tctttgtggc gtttaatttg       960
     atggaagccc ttctgccctc acttatcagt aaagagtcgc cagcaggtta caaaggtacg      1020
     gcgatgggtg tctactccac cagccagttt cttggcgtgg cgattggcgg ttcgctgggc      1080
     ggctggattg acggcatgtt tgacggtcag ggggtatttc tcgctggcgc aatgctggcc      1140
     gcagtgtggc tggcagtcgc cagtaccatg aaagaaccgc cgtatgtcag cagtttgcgc      1200
     attgaaatcc cggcggacat tgccgcaaac gaagcgttaa aagtgcgttt gctggaaact      1260
     gaaggcgtca aagaagtgtt gattgcagaa gaagagcatt cagcttatgt gaaaatcgac      1320
     agcaaagtga caaatcgctt tgaggttgaa caggcaattc gtcaggcata a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page