(data stored in ACNUC7421 zone)

EMBL: CP000038.YBAL

CP000038.YBAL        Location/Qualifiers
FT   CDS_pept        complement(493646..495322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="SSON_0465"
FT                   /old_locus_tag="SSO_0465"
FT                   /product="putative transport protein"
FT                   /note="Code: P; COG: COG4651"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87241"
FT                   /db_xref="GOA:Q3Z4S1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4S1"
FT                   /protein_id="AAZ87241.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKAIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSVAALFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVTYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
     atgcatcacg ccaccccgct tatcaccacc attgttggcg gccttgtgct cgcctttatc        60
     ctcggcatgc tggccaataa actacgtatt tctcctctgg tgggatatct gttagcgggt       120
     gtgctggcag gaccattcac tccgggcttt gttgccgata ccaagcttgc gccggaactg       180
     gctgaactgg gcgtcattct gttgatgttt ggcgtcggtt tgcacttttc gctgaaggat       240
     ttgatggcgg taaaggccat cgccattccc ggtgcgatcg cccagatagc cgtggcgacg       300
     ctgctgggta tggcgctctc tgccgtgctg ggctggtcgt taatgaccgg tatcgtgttc       360
     ggtttatgtc tttccaccgc cagtaccgtg gtgttactgc gcgcacttga agaacggcaa       420
     ttaattgaca gtcagcgtgg gcaaatcgcc atcggttggt tgattgtgga agacctggta       480
     atggttctga cgctggtgtt gctgcccgca gtggcaggaa tgatggaaca gggcgatgtg       540
     ggctttgcca ctcttgcagt cgatatgggg atcaccatcg gcaaagtgat cgcatttatc       600
     gccattatga tgctggtagg tcgccgtctg gtgccgtgga ttatggcacg cagcgcggca       660
     accggttctc gcgagctatt taccctgtcg gtgctggcgc tggcgttagg gattgccttt       720
     ggtgcggtgg agttgtttga cgtctccttc gcacttggcg cgttctttgc cgggatggta       780
     ctgaacgagt ctgaactgag tcaccgtgcc gcccacgata cgctgccatt gcgcgacgcg       840
     tttgcggtgc tgttttttgt ctccgtcggg atgttgtttg atccgttaat tctgattcag       900
     caaccgctgg cagtgctggc gacgctggca attattctgt ttggtaaatc ggtcgcggcc       960
     ctgttccttg tccgtctgtt tggtcactcc caacgtacgg cattaaccat cgccgccagc      1020
     ctggcgcaga ttggtgagtt cgcgtttatc ctggcgggac tgggaatggc attgaattta      1080
     ctgccgcagg ccggacaaaa cctggtactg gcaggggcga tcctgtcgat tatgctcaac      1140
     ccggtactgt tcgcactact ggagaaatat ctggcgaaga ccgaaacgct ggaagagcag      1200
     acgctggaag aggcaatcga agaagagaaa cagatcccag tggatatttg caaccatgcg      1260
     ctattggtgg gttacggtcg tgtaggcagc ctgctggggg agaaattgct cgcctctgat      1320
     attccgctgg tggtgattga gacgtcacga acccgtgttg atgagctgcg agagcgtggg      1380
     gtccgcgctg tattgggcaa tgcagcgaac gaagaaatta tgcaactggc gcatctggaa      1440
     tgtgcaaaat ggctgatcct gacgatcccc aacggttatg aagcgggtga gattgtggcg      1500
     tctgcccgcg cgaaaaaccc ggatattgag attatcgccc gcgcccatta tgacgatgaa      1560
     gtgacgtata tcaccgaacg tggcgcgaat caggtagtga tgggtgaacg tgaaattgcc      1620
     cgtactatgc tggaactgct ggaaacgcca ccggcgggtg aagtggtgac ggggtaa         1677
//

If you have problems or comments...

PBIL Back to PBIL home page