(data stored in ACNUC7421 zone)

EMBL: CP000038.YBAU

CP000038.YBAU        Location/Qualifiers
FT   CDS_pept        450712..452583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaU"
FT                   /locus_tag="SSON_0424"
FT                   /old_locus_tag="SSO_0424"
FT                   /product="putative protease maturation protein"
FT                   /note="Code: O; COG: COG0760"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87200"
FT                   /db_xref="GOA:Q3Z4W2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4W2"
FT                   /protein_id="AAZ87200.1"
FT                   /translation="MMDSLRTAANSLVLKIIFGIIIVSFILTGVSGYLIGGGNNYAAKV
FT                   NDQEISRGQFENAFNSERNRMQQQLGDQYSELAANEGYMKTLRQQVLNRLIDEALLDQY
FT                   ARELKLGISDEQVKQAIFATPAFQVDGKFDNSRYNGILNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVAQQRVVREATIDVNALAAKQPVTEQEIASYYEQNK
FT                   NNFMTPEQFRVSYIKLDAATMQQPVSDADIQSYYDQHQDQFTQPQRTRYSIIQTKTEDE
FT                   AKAVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSG
FT                   VIKSSVGFLIVRLDDIQPAKVKSLDEVRDDIAAKVKHEKALDAYYALQQKVSDAASNDT
FT                   ESLAGAEQAAGVKATQTGWFSKDNLPEELNFKPVADAIFNGGLVGENGAPGINSDIITV
FT                   DGDRAFVLRISEHKPEAVKPLADVQEQVKALVQHNKAEQQAKVDAEKLLVDLKAGKGAE
FT                   AMQAAGLKFGEPKTLSRSGRDPISQAAFALPLPAKDKPSYGMATDMQGNVVLLALDEVK
FT                   QGSMPEDQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
     atgatggaca gcttacgcac ggctgcaaac agtctcgtgc tcaagattat tttcggtatc        60
     attatcgtgt cgttcatatt gaccggcgtg agtggttacc tgattggcgg aggcaataac       120
     tacgccgcaa aagtgaatga ccaggaaatc agccgtgggc agttcgagaa cgcctttaac       180
     agcgagcgta atcgcatgca gcaacagctg ggcgatcaat actccgagct ggcagcgaac       240
     gaaggctata tgaaaaccct gcgtcaacag gtgctgaatc gtctgatcga cgaggcgctg       300
     ttggatcagt acgctcgtga gctgaaactg ggtatcagtg atgagcaggt taaacaggcg       360
     attttcgcga ccccagcctt ccaggttgac ggcaaatttg ataacagccg ctataacggt       420
     atcctcaacc agatggggat gaccgccgat cagtacgccc aggcgctgcg taaccagctc       480
     actacccaac agctgattaa cggtgttgcc ggtaccgatt ttatgctgaa aggtgaaacc       540
     gacgagctgg cggcactggt cgcgcaacaa cgcgtggtgc gtgaggcgac tatcgatgtt       600
     aacgcgctgg cggcgaagca gcctgtgacc gaacaggaga ttgccagcta ctacgaacaa       660
     aacaaaaaca atttcatgac gccggaacaa ttccgcgtga gttacatcaa gctggatgcc       720
     gcaacgatgc agcaaccggt tagcgatgcg gatatccaga gctactacga tcagcatcag       780
     gatcaattca cccagccgca gcgtacccgc tacagcatca tccagaccaa aactgaagat       840
     gaagcgaaag cggtacttga tgagctgaat aaaggcggtg attttgctgc attagccaaa       900
     gaaaaatctg ccgatattat ctctgcccgt aacggcggcg atatgggttg gttagaagat       960
     gccactatcc ccgacgaact gaaaaatgct ggtctgaaag aaaaaggcca actgtctggt      1020
     gtcatcaaat cttcggtcgg tttcctgatt gtacgtctgg acgacattca gccagcgaaa      1080
     gtgaaatcgt tagacgaagt acgtgacgac attgcggcga aagtgaaaca cgaaaaagcc      1140
     ctcgatgcgt actatgcgct gcagcagaaa gtgagcgatg cggcaagcaa cgacaccgag      1200
     tctctggccg gtgcagagca agctgccggc gttaaagcca ctcagacggg ttggttcagc      1260
     aaagataacc tgccggaaga gttgaacttc aagccggttg ccgacgctat ctttaacggc      1320
     ggtctggtag gtgaaaacgg cgcgccgggc atcaactctg acatcatcac cgtagacggc      1380
     gaccgcgcat tcgtgctgcg catcagcgag cacaaaccgg aagcggtgaa accgttggca      1440
     gatgttcagg aacaagttaa ggcactggtt cagcacaaca aagctgaaca acaggcgaaa      1500
     gtggatgctg agaaactgct ggttgatttg aaagccggca aaggggcgga agctatgcag      1560
     gctgccggtc tgaaatttgg cgagccgaaa accttaagcc gttccggtcg tgacccgatt      1620
     agccaggcgg cgtttgcact gccactgcca gcgaaagaca aaccgagcta cggtatggcg      1680
     accgatatgc aaggtaatgt ggttctgctg gcgctggatg aagtgaaaca aggttcaatg      1740
     ccggaagatc agaaaaaagc gatggtgcag ggtatcaccc agaacaacgc acaaatcgtc      1800
     tttgaagctc tgatgagtaa cctgcgtaaa gaggcgaaaa tcaaaattgg cgatgcgctg      1860
     gaacagcaat aa                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page