(data stored in ACNUC7421 zone)

EMBL: CP000038.YBBF

CP000038.YBBF        Location/Qualifiers
FT   CDS_pept        523345..524067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbF"
FT                   /locus_tag="SSON_0494"
FT                   /old_locus_tag="SSO_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2908"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87269"
FT                   /db_xref="GOA:Q3Z4P3"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4P3"
FT                   /protein_id="AAZ87269.1"
FT                   /translation="MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEA
FT                   WIGDDEPNPLHRQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLE
FT                   LYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQMLFLALPLFVRKRIAARMRANSKEA
FT                   NSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTE
FT                   GSMVKVTADDVELIHFPF"
     gtggcgacac tctttattgc agatcttcat ctctgcgtgg aagaaccggc gatcaccgcc        60
     ggttttctgc gttttttagc gggggaagct cgcaaggccg acgcgctgta tattcttggc       120
     gatctgtttg aagcgtggat tggcgacgac gagcccaatc cactccatcg ccagatggcg       180
     gcagcgatca aagcggtgtc cgattctggc gttccctgtt atttcattca tggcaaccgt       240
     gattttctgc tcggcaaacg ctttgcccgt gaaagtggca tgacgttatt gccggaagaa       300
     aaggtgctcg aactttatgg ccgccgggtg ttgattatgc atggcgacac gctgtgcacc       360
     gatgacgcgg gttatcaggc ttttcgcgcc aaagtccaca aaccctggct gcaaatgcta       420
     ttcctcgccc tgccgttgtt tgtgcgcaaa cgcattgccg cgcgaatgcg agcgaacagt       480
     aaagaagcca acagcagtaa atcgctggcg atcatggacg ttaaccaaaa cgcggtagtc       540
     agtgcgatgg aaaaacatca ggtgcaatgg ctgatccacg gacataccca tcgcccggcg       600
     gtacatgaac ttatcgccaa ccagcaacct gcttttcgcg tggtactcgg tgcctggcat       660
     acggaaggtt cgatggtgaa agtcacggcg gatgacgttg agctgattca ttttccgttt       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page