(data stored in ACNUC7421 zone)

EMBL: CP000038.YBCJ

CP000038.YBCJ        Location/Qualifiers
FT   CDS_pept        520391..520624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="SSON_0490"
FT                   /old_locus_tag="SSO_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: S; COG: COG2501"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87265"
FT                   /db_xref="GOA:Q3Z4P7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4P7"
FT                   /protein_id="AAZ87265.1"
FT                   /translation="MIHRVSNMATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQ
FT                   VKADGAVETRKRCKIVAGQTVSFAGHSVQVVA"
     atgatccaca gggtgagtaa catggcgaca ttttctttag gtaaacatcc gcacgttgag        60
     ctgtgcgact tgctgaaact ggaaggctgg agcgaaagcg gcgcgcaggc gaaaatcgcg       120
     attgccgaag gccaggtgaa agccgacggc gcggttgaaa cgcgcaaacg ctgcaaaatc       180
     gtcgccggtc agacagtgag ttttgcaggt cacagcgtac aggttgttgc ctga             234
//

If you have problems or comments...

PBIL Back to PBIL home page