(data stored in ACNUC7421 zone)

EMBL: CP000038.YBDU

CP000038.YBDU        Location/Qualifiers
FT   CDS_pept        complement(606487..607038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdU"
FT                   /locus_tag="SSON_0566"
FT                   /old_locus_tag="SSO_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="Code: HI; COG: COG3697"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87333"
FT                   /db_xref="GOA:Q3Z4H9"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3Z4H9"
FT                   /protein_id="AAZ87333.1"
FT                   /translation="MHLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTV
FT                   VAPGPIKDSEVTRRIFNHGVTALRALAAKQGWQIQEQAALVSASGPEGMLSIAAPARDL
FT                   KLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCARGKTHQL
FT                   TDLLNRMEALLNDVDACNVN"
     atgcacctgc ttcctgaact cgccagccac catgcggtgt caattcccga gctgctcgtc        60
     agccgggatg aaaggcaagc acggcaacac gtctggctca agcgccatcc tgttccactg       120
     gtctccttta ccgtggttgc gcctgggccg attaaagaca gcgaggtcac acgccgaatt       180
     tttaatcatg gcgtgacagc cttgcgtgcc ttagccgcaa aacagggctg gcaaattcag       240
     gagcaggctg cactggtttc cgccagcggg ccggagggca tgttgagcat tgccgccccg       300
     gctcgcgacc tcaagctcgc caccattgag cttgaacata gtcatcctct cgggcggtta       360
     tgggatatcg atgtcctgac gcccgaaggc gaaattctct cccgccgcga ctattcactg       420
     ccgcctcgcc gctgcctgtt gtgcgagcaa agcgcagccg tctgcgcgcg tggaaaaacc       480
     catcaactga ccgatttact caaccgcatg gaggcactgc tgaacgatgt cgatgcctgc       540
     aacgtcaact aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page