(data stored in ACNUC7421 zone)

EMBL: CP000038.YBFL

CP000038.YBFL        Location/Qualifiers
FT   CDS_pept        286237..287094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfL"
FT                   /locus_tag="SSON_0259"
FT                   /old_locus_tag="SSO_0259"
FT                   /product="putative receptor protein"
FT                   /note="Code: L; COG: COG5433"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87043"
FT                   /db_xref="GOA:Q3Z5B9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5B9"
FT                   /protein_id="AAZ87043.1"
FT                   /translation="MRDCHSSDDKDVIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSL
FT                   VIGQIKTDEKSNEITAIPELLNMLDIKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKG
FT                   NQGRLNKAFEEKFPLKELNNPEHDSYAMSEKSHGREEIRLHIVCDVPDELIDFTFEWKG
FT                   LKKLCVAVSFRSIIAEQKKEPEMTVRYYISSADLTAEKFATAIRNHWHVENKLHWRLDV
FT                   VMNEDDCKIRRGNAAELFSGIRHIAINILTNDKVFKAGLRRKMRKAAMDRNYLASVLAG
FT                   SGLS"
     atgcgtgact gccattcttc agatgataaa gacgtcattg caattgatgg aaaaacgctc        60
     cggcactctt atgacaagag tcgccgcagg ggagcgattc atgtcattag tgcgttctca       120
     acaatgcaca gtctggtcat cggacagatc aagacggatg agaaatctaa tgagattaca       180
     gctatcccag aacttcttaa catgctagat attaaaggaa aaatcatcac aactgatgcg       240
     atgggttgcc agaaagatat tgcagagaag atacaaaaac agggaggtga ttatttattc       300
     gcggtaaaag gaaaccaggg gcggctaaat aaagcctttg aggaaaaatt tccgctgaaa       360
     gaattaaata atccagagca tgacagttac gcaatgagtg aaaagagtca cggcagagaa       420
     gaaatccgtc ttcatattgt ttgcgatgtc cctgatgaac ttattgattt cacgtttgaa       480
     tggaaaggac tgaagaaatt atgcgtggca gtctcctttc ggtcaataat agcagaacaa       540
     aagaaagagc cagaaatgac ggtcagatat tatatcagtt ctgctgattt aaccgcagaa       600
     aagttcgcca cagcaatccg aaaccactgg cacgtggaga ataagctgca ctggcgtctg       660
     gacgtggtaa tgaatgaaga cgactgcaaa ataagaagag gaaacgccgc agaattattt       720
     tcagggatac ggcacatcgc tattaatatt ttaacgaatg ataaggtatt caaggcaggg       780
     ttaagacgta agatgcgaaa agcagccatg gatagaaact atctcgcgtc agtccttgcg       840
     gggagcgggc tttcgtaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page