(data stored in ACNUC7421 zone)

EMBL: CP000038.YHHI

CP000038.YHHI        Location/Qualifiers
FT   CDS_pept        288388..289524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhI"
FT                   /locus_tag="SSON_0260"
FT                   /old_locus_tag="SSO_0260"
FT                   /product="putative receptor"
FT                   /note="Code: L; COG: COG5433"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87044"
FT                   /db_xref="GOA:Q3Z5B8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z5B8"
FT                   /protein_id="AAZ87044.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHLDFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSDDKD
FT                   VIAIDGKTLRHSYDKSRRKGAIHVISAFSTMHSLVLGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAESGLS"
     atggaactta aaaaactgat ggaacatatt tctattatcc ccgattacag acaagcctgg        60
     aaagtagaac ataaattgtc agatattcta ctgttgacta tttgtgccgt catttctggt       120
     gcagagggtt gggaagatat agaggatttt ggtgaaacac atctcgattt tttgaagcaa       180
     tatggtgatt ttgaaaatgg tattcctgtt cacgatacta ttgccagagt tgtatcctgt       240
     atcagtcctg caaaatttca cgagtgcttt attaactgga tgcgtgactg ccattcttca       300
     gatgataaag acgtcattgc aattgatgga aaaacgctcc ggcactctta tgacaagagt       360
     cgccgcaagg gagcgattca tgtcattagt gcgttctcaa caatgcacag tctggttctc       420
     gggcagatta agacggatga gaaatccaat gagattacag ccattcctga acttcttaac       480
     atgctggata ttaaaggaaa aatcatcaca actgatgcga tgggatgcca gaaagatatt       540
     gcagagaaga tacaaaaaca gggcggtgat tatttattcg cggtaaaagg aaaccagggg       600
     cggcttaata aagcctttga ggaaaaattt ccgctgaaag aattaaataa tccagagcat       660
     gacagttacg caatcagtga aaagagtcac ggcagagaag aaatccgtct tcatattgtt       720
     tgcgatgtcc ctgatgaact tattgatttc acgtttgaat ggaaagggct gaagaaatta       780
     tgcgtggcag tctcctttcg gtccataata gcagaacaaa agaaagagcc agaaatgacg       840
     gtcagatatt atatcagttc tgctgattta accgcagaga agttcgccac agcaatccga       900
     aaccactggc acgtggagaa taagctgcac tggcgtctgg acgtggtaat gaatgaagac       960
     gactgcaaaa taagaagagg aaatgcagca gaattatttt cagggatacg gcacatcgct      1020
     attaatattt tgacgaatga taaggtattc aaggcagggt taagacgtaa gatgcgaaaa      1080
     gcagctatgg acagaaacta tctggcgtca gtccttgcgg agagcgggct ttcgtag         1137
//

If you have problems or comments...

PBIL Back to PBIL home page