(data stored in ACNUC7421 zone)

EMBL: CP000038.YKGI

CP000038.YKGI        Location/Qualifiers
FT   CDS_pept        351334..351585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="SSON_0321"
FT                   /old_locus_tag="SSO_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87099"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z563"
FT                   /protein_id="AAZ87099.1"
FT                   /translation="MMVFYMFKKSVLFATLLSGVMEFSTNADDKIILKHISVSSVSASP
FT                   TVLEDTIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
     ttgatggtat tttatatgtt taaaaaatct gttttatttg caacactatt atctggcgtt        60
     atggaatttt ccaccaatgc agatgataaa ataattctga aacatatcag cgtctcgtca       120
     gtatcagcat caccgacagt tctggaggat accattgctg atatagccag aaaatataat       180
     gcttcatcct ggaaagtcac atcgatgcga attgataata attcaaccgc aacagcagta       240
     ttgtataaat aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page