(data stored in ACNUC7421 zone)

EMBL: CP000038.YLBE

CP000038.YLBE        Location/Qualifiers
FT   CDS_pept        complement(527449..528450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="SSON_0499"
FT                   /old_locus_tag="SSO_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87274"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4N8"
FT                   /protein_id="AAZ87274.1"
FT                   /translation="MNFIPCHHVNAVGPMGGITSASMPMLVVENVTDGNRAYCNLNEGI
FT                   GKVMRFGAYGEDVLTRHRWMRDVLMPVLSAALGRMERGIDLTAMMAQGITMGDEFHQRN
FT                   IASSALLMRALAPQIARLDHDKQHIAEVMDFLSVTDQFFLNLAMAYCKAAMDAGAMIRA
FT                   GSIVTAMTRNGNMFGIRVSGLGERWFTAPVNTPQGLFFTGFSQEQANPDMGDSAITETF
FT                   GIGGAAMIAAPGVTRFVGAGGMEAARAVSEEMAEIYLERNMQLQIPGWDFQGACLGLDI
FT                   RRVVETDITPLINTGIAHKEAGIGQIGAGTVRAPLACFEQALEALAESMGIG"
     gtgaacttca ttccttgtca ccatgtgaat gccgtcggtc caatgggcgg tattacttct        60
     gccagtatgc cgatgctggt ggtcgagaac gtgaccgacg gcaaccgggc gtactgcaac       120
     ctcaacgaag gtatcggcaa agtgatgcgt tttggcgctt acggcgaaga tgtcctgact       180
     cgccatcgct ggatgcgcga tgtgttaatg ccagtattaa gcgcggcgct ggggcgcatg       240
     gagcgcggta tcgatctcac ggcgatgatg gcgcagggca ttacgatggg cgatgagttc       300
     catcaacgca atattgcttc ctctgcactg ttaatgcgtg cgctggcccc acaaattgct       360
     cgcctcgatc atgataaaca gcacatcgcc gaagtgatgg atttcctcag cgtgaccgat       420
     cagttcttcc tcaacctcgc gatggcttac tgcaaggcgg cgatggatgc tggcgcgatg       480
     atccgcgcag gcagcatcgt cacggcaatg acccgcaacg gcaatatgtt cgggattcgg       540
     gtaagcgggc tgggcgaacg ctggtttact gcgcctgtaa acactccgca aggtctgttt       600
     ttcaccggct tctcgcagga gcaggcgaac ccggatatgg gcgatagcgc gattaccgaa       660
     acctttggta tcggaggtgc ggcaatgatc gcagcgcctg gcgtaacgcg ctttgtcggt       720
     gcgggtggca tggaagcggc cagagcggta tctgaagaga tggcggaaat ttaccttgag       780
     cgcaatatgc agttgcagat cccaggctgg gattttcagg gcgcgtgcct gggactggac       840
     attcgtcgcg tggtagaaac cgacattacg ccactcatca ataccggtat cgcccataaa       900
     gaggcgggga tcgggcagat tggcgcaggc actgtgcggg caccgctggc gtgttttgaa       960
     caggcgctgg aagcactggc tgaaagcatg gggattggtt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page