(data stored in ACNUC7421 zone)

EMBL: CP000038.YLCD

CP000038.YLCD        Location/Qualifiers
FT   CDS_pept        557796..559019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylcD"
FT                   /locus_tag="SSON_0525"
FT                   /old_locus_tag="SSO_0525"
FT                   /product="putative resistance protein"
FT                   /note="Code: M; COG: COG0845"
FT                   /db_xref="EnsemblGenomes-Gn:SSON_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ87294"
FT                   /db_xref="GOA:Q3Z4L8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3Z4L8"
FT                   /protein_id="AAZ87294.1"
FT                   /translation="MKKIALIIGSMIAGGIISAAGFTWFAKAEPPAEKTSTAERKILFW
FT                   YDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPL
FT                   TFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQS
FT                   EYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFD
FT                   LRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKW
FT                   TLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGNEQR
FT                   VITVDADGRFVPKRVAVFQASQGVTALHSGLAEGEKVVSSGLFLIDSEANISGALERMR
FT                   SESATNAH"
     atgaaaaaaa tcgcgcttat tatcggcagc atgatcgcgg gcggtattat ttctgcggca        60
     ggttttacct ggtttgcaaa ggctgaacca cccgcagaaa aaacgtcgac cgcagaacgt       120
     aaaatcttat tctggtacga cccgatgtac cccaatacgc ggttcgataa accaggtaaa       180
     tcgccgttta tggatatgga tctggtgccg aaatatgccg atgaagagag ttctgcgtct       240
     ggtgtgcgca ttgacccgac tcagacgcag aatctggggg tgaaaacggc taccgtcacg       300
     cgcggaccgc tgacttttgc ccagagtttc ccggcgaatg tcagttacaa cgagtatcag       360
     tatgccattg tgcaggctcg cgctgccggg tttatcgaca aggtgtatcc gcttaccgtg       420
     ggcgataaag tacaaaaggg cacaccgctt ctcgacctga ccattcctga ctgggtggaa       480
     gcgcagagtg agtatttact gctgcgcgaa accggcggta cggcgaccca gactgaaggc       540
     attcttgagc ggctgcgact ggcgggaatg ccggaggcgg atattcgccg cctgatcgcc       600
     acgcaaaaaa tccagactcg ctttacgctc aaagcaccca ttgatggcgt gatcaccgcg       660
     tttgatctgc gcgcgggaat gaatatcgcc aaagataacg tggtagcgaa aattcagggt       720
     atggacccgg tgtgggtcac tgctgcgatc ccggagtcta tcgcctggct ggtgaaagat       780
     gcctcgcagt ttacgctcac cgttccggcg cgaccggata aaacactcac catccgcaaa       840
     tggacgctgc tacctggcgt ggatgccgcg acccgcacgc tgcagctgcg tctggaagtc       900
     gacaacgccg acgaggcgct aaaaccgggc atgaacgcct ggttgcaact caacaccgcc       960
     agcgaaccga tgctgctcat tccgtcacag gcgctgattg ataccggcaa cgaacagcgg      1020
     gtgattaccg ttgatgccga cggacgcttt gtaccgaaac gcgttgccgt tttccaggca      1080
     tcgcaaggcg tcaccgcgtt acactctggt ctggcggaag gtgaaaaggt ggtttccagc      1140
     ggcctgttcc tgattgattc cgaagccaat atttctggcg cactggagcg gatgcgctct      1200
     gaaagtgcta ccaatgcgca ttga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page